KEGG   Desulfosporosinus orientis: Desor_0223Help
Entry
Desor_0223        CDS       T01675                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
dor  Desulfosporosinus orientis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dor00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desor_0223
Enzymes [BR:dor01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Desor_0223
Amino acid related enzymes [BR:dor01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Desor_0223
Transfer RNA biogenesis [BR:dor03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Desor_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214177..215640
Genome map
AA seq 487 aa AA seqDB search
MTIRVRFAPSPTGPLHIGGARSALFNYLWARKNNGTFIVRSEDTDLERSSRKSEQNILEA
LRWLNIQWNEGIEVGGDHGPYRQTDRLGLYAEYTEKLIAGGHAYYCYCSEEEIEQERQEL
LAKGETPRYLGKCRHLTAEQRAALEIEGRKPVVRFRVPKGQAIHISDQVRGDVVFESDGI
GDYVIVKSDGIPTYNFAVVVDDITMGITHVIRGEEHLSNTPRQVLIYQALGVPAPEFAHI
SLIHNSEGRKMSKRDGDTAVIDYQRKGYLSEAIVNFIALLGWAPSGEKEFYTLDELAEAF
TLDRVSKSPAVFDRHKLDYINTHYLKETSLEQLAELALPHLEELNIPSREKRSTEQQEWL
ETFVKAILDKISYLAEAKNYIHYFHGSIPLEPDGEAIDVLKGEQVPGVLALFKRKVQETE
TLTGETVKTLLKQMTKELKLGGKLVYMPVRVALTGQMHGPELYDIIPLLGRENVLGRIAM
TEERYFA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcgagttcgatttgcacctagcccgacgggcccgcttcatatcggaggggcg
agatcggctttatttaattatctgtgggctcgtaagaacaatgggacatttattgtacgc
agtgaagacacagatctggagcgttcaagcagaaaatctgaacaaaatattttagaagcc
ctgcgctggttaaatattcaatggaatgaaggaatcgaagttggcggtgaccatggtcct
tatcgccagacggatcgtttagggctttacgcagagtataccgaaaaattaatagccggt
ggtcacgcttattattgctattgttcggaagaggaaatagagcaggaacgtcaagagtta
cttgctaaaggagaaactccccgctatctgggaaaatgccgccatttgaccgcagagcag
cgggctgccctggagattgaagggcgaaagccggtggtccgcttccgcgtgccgaaagga
caagccattcatatttctgatcaagttcgcggggacgtggtatttgagagcgatgggatt
ggggattatgtcattgttaaatccgatggaattcccacctataatttcgcagtggttgtg
gatgatattaccatgggaatcactcacgtaattcgaggtgaggagcatctgtccaatact
ccgaggcaagttctgatttatcaagccctgggagttcctgcgcctgaatttgctcatatt
tccctgatccataattccgaagggcgtaagatgagcaaacgggatggggacactgcggta
atagattatcaaaggaagggatatctctccgaggctattgtgaattttatagccctcctt
ggctgggcgccttcgggggaaaaagaattttacaccctggatgagttggcagaggccttt
accctggaccgggtttctaaaagccctgctgtgtttgatcggcataaactggattatatt
aacacacattatcttaaagaaacttccctcgaacaactggctgagctcgcattgccgcat
ctggaggaattaaatataccttctcgggagaaacggtcaacagagcagcaggagtggctg
gaaacctttgttaaagctattttggataaaatttcttacctggctgaagcaaagaactat
atccactattttcatgggagtattccccttgagccggatggcgaagcaattgacgtgttg
aagggagagcaggttccgggtgtcttggcattatttaaaaggaaggtgcaggagacagaa
acactcacgggagaaactgtgaagacccttttaaaacaaatgacgaaagagttgaaactc
ggcggcaaattagtatatatgccggtccgggtggctttgaccgggcaaatgcatggtccg
gagctttatgatattatccccttattagggcgtgagaatgttttaggacggatcgctatg
acagaggagcgttattttgcatag

DBGET integrated database retrieval system