KEGG   Desulfosporosinus orientis: Desor_0494Help
Entry
Desor_0494        CDS       T01675                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dor  Desulfosporosinus orientis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dor00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dor00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dor02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
490350..491837
Genome map
AA seq 495 aa AA seqDB search
MFKKNHFKGIASICVIGTILISLVAAQPNLGIAKSANEEIYKGKTPKYVFMFIGDGMSYA
QISSAEMYLGEKSMPGKLTPEQLSFTKFPVHGSLMTQDSSSFIPDSASTATSLASGHKTL
SGVINMDETKTHEYKPITEDLKAKGYKIGIITSVPITHATPAAYYAKVANRNDAYEIGKQ
LAASGFDYFGGGDFDQKTGPEGTDQPIYDIVEEAGYTIANTKEEIQALNNRSGKVVAIDP
DDYETALDYEIDREPGELALADYVKKGIDVLNNNKGFFMMVEGGKIDWANHANDAAASIY
DTVAFDDSVKVALDFYNAHPKDTLILVTADHECGGMTIGYSLTGYSTHFEKLQPVTMSYQ
EFDKISKLYKGTNPANPKLEDLSANIKEAYGLDLATLTPYEASLLNNAFAKFMSADTKPA
NDQESVLYGTYNPLSVTLSHIMNNRAGLSFTTYSHTGVPVPIYAVGTGSELFDGYYDNTK
VYYKLASITQSSQAK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaagaaccacttcaagggaatcgcgtctatttgtgtaattggtacaatactt
atatccctggtggccgcccagccaaatctggggatagcaaagtcagcgaacgaggagatt
tataaaggaaaaaccccaaaatatgtgtttatgtttatcggagacggtatgagctatgcc
caaatcagcagcgctgaaatgtatctcggtgaaaaatccatgcccggaaagctcactccc
gagcaactgagcttcactaagttccccgttcacggatcacttatgacgcaagattcgtct
tcatttattcctgattctgcttcaacagctacttcccttgcatcaggccataaaactctc
tccggcgtaatcaacatggacgagacgaagactcatgagtacaagccaattacggaagat
ttaaaggcaaaaggctataaaatcggaattataaccagcgttcctattacccacgctacg
ccggcggcctactatgccaaggtggccaacagaaatgatgcctacgaaataggcaaacaa
ctggcagccagcggttttgattattttggcggcggtgattttgatcaaaagaccgggccg
gagggaaccgaccagcctatctatgatattgttgaggaagcaggctataccatagccaat
accaaagaagaaatccaggccttaaataaccgttcaggcaaagtggttgccattgatccc
gacgattatgaaacagccttagactatgaaatcgaccgggaaccaggcgaactggctctg
gccgattatgtcaaaaagggaattgatgtcttaaacaacaacaaaggcttctttatgatg
gtggaaggcggaaaaattgactgggcaaaccatgccaatgatgccgcggcttccatctat
gataccgttgcctttgatgattctgttaaagtggctttagatttctataatgcacaccct
aaagataccttgattctggtcacagctgaccatgagtgcggaggcatgactattggttat
tctctgacaggttacagcacccatttcgagaagctgcagccggtaaccatgtcttatcag
gaatttgacaaaatcagtaaactgtacaaaggaaccaatcctgccaatcccaagctggag
gatttaagcgctaatattaaagaagcctatggactggaccttgcaacattgactccatac
gaagcctccttgctgaataatgcctttgccaagttcatgtcagcggatacaaagcctgca
aacgaccaggaaagtgttctttacgggacctataaccccttgtcggtgactctctctcat
atcatgaataaccgagccggactgagctttaccacctattcccatacaggcgtacctgta
cccatttatgccgtaggtaccggttctgagctgtttgacgggtactatgataatacgaag
gtttactataagcttgcttctataacccaaagctcacaggcaaagtaa

DBGET integrated database retrieval system