KEGG   Desulfosporosinus orientis: Desor_0494Help
Entry
Desor_0494        CDS       T01675                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dor  Desulfosporosinus orientis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desor_0494
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Desor_0494
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desor_0494
Enzymes [BR:dor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Desor_0494
Exosome [BR:dor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desor_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
490350..491837
Genome map
AA seq 495 aa AA seqDB search
MFKKNHFKGIASICVIGTILISLVAAQPNLGIAKSANEEIYKGKTPKYVFMFIGDGMSYA
QISSAEMYLGEKSMPGKLTPEQLSFTKFPVHGSLMTQDSSSFIPDSASTATSLASGHKTL
SGVINMDETKTHEYKPITEDLKAKGYKIGIITSVPITHATPAAYYAKVANRNDAYEIGKQ
LAASGFDYFGGGDFDQKTGPEGTDQPIYDIVEEAGYTIANTKEEIQALNNRSGKVVAIDP
DDYETALDYEIDREPGELALADYVKKGIDVLNNNKGFFMMVEGGKIDWANHANDAAASIY
DTVAFDDSVKVALDFYNAHPKDTLILVTADHECGGMTIGYSLTGYSTHFEKLQPVTMSYQ
EFDKISKLYKGTNPANPKLEDLSANIKEAYGLDLATLTPYEASLLNNAFAKFMSADTKPA
NDQESVLYGTYNPLSVTLSHIMNNRAGLSFTTYSHTGVPVPIYAVGTGSELFDGYYDNTK
VYYKLASITQSSQAK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaagaaccacttcaagggaatcgcgtctatttgtgtaattggtacaatactt
atatccctggtggccgcccagccaaatctggggatagcaaagtcagcgaacgaggagatt
tataaaggaaaaaccccaaaatatgtgtttatgtttatcggagacggtatgagctatgcc
caaatcagcagcgctgaaatgtatctcggtgaaaaatccatgcccggaaagctcactccc
gagcaactgagcttcactaagttccccgttcacggatcacttatgacgcaagattcgtct
tcatttattcctgattctgcttcaacagctacttcccttgcatcaggccataaaactctc
tccggcgtaatcaacatggacgagacgaagactcatgagtacaagccaattacggaagat
ttaaaggcaaaaggctataaaatcggaattataaccagcgttcctattacccacgctacg
ccggcggcctactatgccaaggtggccaacagaaatgatgcctacgaaataggcaaacaa
ctggcagccagcggttttgattattttggcggcggtgattttgatcaaaagaccgggccg
gagggaaccgaccagcctatctatgatattgttgaggaagcaggctataccatagccaat
accaaagaagaaatccaggccttaaataaccgttcaggcaaagtggttgccattgatccc
gacgattatgaaacagccttagactatgaaatcgaccgggaaccaggcgaactggctctg
gccgattatgtcaaaaagggaattgatgtcttaaacaacaacaaaggcttctttatgatg
gtggaaggcggaaaaattgactgggcaaaccatgccaatgatgccgcggcttccatctat
gataccgttgcctttgatgattctgttaaagtggctttagatttctataatgcacaccct
aaagataccttgattctggtcacagctgaccatgagtgcggaggcatgactattggttat
tctctgacaggttacagcacccatttcgagaagctgcagccggtaaccatgtcttatcag
gaatttgacaaaatcagtaaactgtacaaaggaaccaatcctgccaatcccaagctggag
gatttaagcgctaatattaaagaagcctatggactggaccttgcaacattgactccatac
gaagcctccttgctgaataatgcctttgccaagttcatgtcagcggatacaaagcctgca
aacgaccaggaaagtgttctttacgggacctataaccccttgtcggtgactctctctcat
atcatgaataaccgagccggactgagctttaccacctattcccatacaggcgtacctgta
cccatttatgccgtaggtaccggttctgagctgtttgacgggtactatgataatacgaag
gtttactataagcttgcttctataacccaaagctcacaggcaaagtaa

DBGET integrated database retrieval system