KEGG   Desulfosporosinus orientis: Desor_0514Help
Entry
Desor_0514        CDS       T01675                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Organism
dor  Desulfosporosinus orientis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(511520..512518)
Genome map
AA seq 332 aa AA seqDB search
MYNLILNSLSLPSRIPLLDGPTPLQRSRLAWGDDTLYWKRDDLTPLGLGGNKLRKLEFLV
ADALKEKADHIITCGAPQSNHARLTAVVSAMFSLSCSIVIPGETPSQWSGNLLLDRLAGA
DIIPCGDESLEQEMQRVASEIKSQGRKPYIIPLGGSNVLGSLGYFLAFFELLKQAEEQGW
VPSTLVCSVGSAGTFAGLVAANALLPQPLRLLGVNVAEATDRLQLQTTRLADELLNLLHT
PRSLPPFTLSTDFVGPGYGQPSPASSSVLIECFQRDGILFDPVYTAKGVAAVKNLMEHKD
RPFPENIVFWHTGGGPAIFDPHYYTGLLNNIR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgtataatttaatacttaacagtttatccctgccctcgcggattcctttgctggatggc
cctactcccctgcagagaagccgcctggcttggggagatgatacattatattggaagcgg
gatgatttgactcccttgggcctgggcggaaataaactgcgcaagctggaattcttggtt
gctgatgctttaaaggaaaaggccgaccatattattacttgcggagctccccagtctaat
catgcccgcctgactgctgtcgtgtcggcaatgttcagcctttcctgttcaattgttatc
cccggagagacaccaagccaatggagcggcaaccttctcttagatcgtttagcaggagca
gacatcattccttgcggggatgaatcccttgagcaagaaatgcagcgagttgcctctgaa
ataaaatctcaaggccgaaaaccttatataatccctcttgggggatccaatgtcctcgga
tctttaggttacttcttagccttttttgaactccttaaacaggcagaagagcaaggatgg
gttcccagcaccctcgtctgctccgttggaagtgccggaacttttgcaggattagttgcc
gccaatgccctgcttccacaaccccttcgcctgttgggagttaatgtagcggaagcaacg
gatcggcttcagcttcaaacaaccagactcgctgatgaactattaaatctgctgcacact
cctcgctctttgccgccatttactcttagtacagatttcgtggggccgggctatggccag
ccctctccagcctcttccagcgttcttattgagtgcttccaaagggatgggattcttttt
gatcccgtctataccgccaaaggagtagccgcagtcaaaaatctcatggaacataaagat
cgcccattccctgagaacatcgttttctggcacacaggcggcggacctgccatttttgat
cctcattattatacggggcttctgaacaatatcagataa

DBGET integrated database retrieval system