KEGG   Desulfosporosinus orientis: Desor_0612Help
Entry
Desor_0612        CDS       T01675                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dor  Desulfosporosinus orientis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desor_0612
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desor_0612
   00650 Butanoate metabolism
    Desor_0612
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Desor_0612
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desor_0612
   00622 Xylene degradation
    Desor_0612
   00621 Dioxin degradation
    Desor_0612
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Desor_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
609613..610482
Genome map
AA seq 289 aa AA seqDB search
MEKIKVGIIGPGNIGSDLMYKVIKSKHLQMHLMAGIVESEGIKRAAGLGFKTSLEGVDAV
AADPDIKIVFDATSAKAHLYNAPILKAAGKIVMDMTPAAVGPYVVPCVNLDNLAHVDNFN
MVTCGGQATIPIAHAINRVADSEYTEIVAALSSKSAGPGTRANIDEFTQTTKKALEIVGG
ADKAKAIIVLNPAEPPIMMTNTIYSIVKNPDEKKIIESVNEIVKQVQAYVPGYKLRVPPV
IDGNKVTVIVQVQGAGDFLPMYSGNLDIINQAAVAVAEKVAENLLNKEG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaattaaggtaggcatcatcggaccggggaatatcggctctgacctaatgtat
aaggtcattaaaagtaaacatctgcaaatgcacttaatggccggtatcgtggaatctgag
ggaattaaaagggcagccggactggggtttaagacttcgctggaaggtgttgacgctgtg
gccgcagatcccgatatcaagattgtctttgacgcgacaagtgcaaaagcgcatttatat
aatgcaccaatattgaaagcggcgggcaaaatcgttatggatatgactcctgctgcagta
ggcccctacgtggttccctgtgtcaatcttgacaatctggctcatgtggataactttaac
atggtaacctgcggcggacaggccacgattcccattgcccatgcgattaatcgggtggca
gattcagagtataccgagattgtggcggccctttcctctaagagcgcaggtccgggaacc
cgtgccaacattgacgaattcactcagacgaccaaaaaggcccttgaaatcgttggtggt
gcagacaaagcaaaagcaatcattgttctgaaccctgctgaaccgcccattatgatgacc
aataccatttattctatagtcaagaatccggatgagaaaaaaatcattgaatccgttaat
gagattgtcaaacaggttcaagcttatgtgcccggttacaagcttcgtgttccccctgtc
atagatggaaacaaagttaccgtaattgttcaggtacagggtgccggcgactttttaccc
atgtattccgggaaccttgatatcatcaatcaggcagcggtcgccgttgccgaaaaagta
gccgagaatctgttgaacaaggaggggtaa

DBGET integrated database retrieval system