KEGG   Desulfosporosinus orientis: Desor_0732Help
Entry
Desor_0732        CDS       T01675                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dor  Desulfosporosinus orientis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desor_0732
   01230 Biosynthesis of amino acids
    Desor_0732
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_0732
   00030 Pentose phosphate pathway
    Desor_0732
   00051 Fructose and mannose metabolism
    Desor_0732
   00052 Galactose metabolism
    Desor_0732
  Energy metabolism
   00680 Methane metabolism
    Desor_0732
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desor_0732
Protein phosphatases and associated proteins [BR:dor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desor_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738218..739297
Genome map
AA seq 359 aa AA seqDB search
MRKLAVLTGGGDCPGLNAVIRAIVKSAHGYGVEVLGIRDGFRGAVEEDFIPLSLKDVSGI
LPRGGTILGTTNRDNPFAYPTKPNGVIQPLDRSEDVLENLKNNQVDALLAIGGDGSLNIA
LKFANKGLKVIGIPKTIDNDLMSTDQTFGFQTAVDTAQEALDRLHTTAESHHRVMILEVM
GRYAGWIALYAGVAGGADVILIPEIPYNLNRVALSVQNRAKQGKKFSIIVAAEGAKPLGG
EMVVERMMKGRIDPVKLGGIGAKIARDLEEHYGLETRVTVLGHLQRGGSPNAYDRVLSTR
YGTAAVDAALEGEFGVMVALQGKEIVRVPLQEAVDHIKLVPLNNPLLVAARTLGMEFGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaaacttgcggtacttacgggcggaggggattgtcccggtcttaatgcggtgatc
agggcaatcgttaaaagcgcccatggatatggtgttgaagtattgggaatcagagatgga
tttcgcggagctgttgaggaggactttatccctctttcacttaaggacgtttccggaatt
ttaccgcgagggggtactattttaggaacaactaatcgcgacaacccctttgcttatccc
accaaaccgaacggagttattcagcctttggatcgttccgaagatgtgctggagaactta
aagaacaaccaggtcgatgccctattagcaattggcggggacggcagtctgaacattgcc
ctgaagtttgccaataaagggcttaaagtgattggaattcccaagacaattgacaatgat
ttgatgtcaacggatcaaactttcggttttcaaacagcagtggatacggctcaggaagct
ttagaccgcttgcataccacggcagaatctcatcaccgggttatgattcttgaagtcatg
ggccgttatgcgggctggattgccttgtatgccggagttgctgggggagctgatgtcata
cttattccggaaataccctacaaccttaacagggtggctctaagtgttcaaaacagggct
aagcaagggaaaaaattcagcattattgtagcagctgaaggggctaagcccttggggggc
gaaatggtcgttgaacgcatgatgaaagggcggattgatcctgtaaaattaggcgggatc
ggcgctaaaatcgcccgggatcttgaagaacactatggcctggaaacccgggtaaccgta
ctgggacatctgcagaggggaggttcccctaacgcttatgaccgggtgctgtcaacacgc
tacggcacggcagcggtggatgccgctctggaaggagaatttggcgtgatggttgccctt
cagggtaaggagattgtgcgcgttcctcttcaggaagccgttgaccatattaagcttgtg
cctttaaacaatcctttgttggttgcagctcggaccttgggtatggagtttggtgattaa

DBGET integrated database retrieval system