KEGG   Desulfosporosinus orientis: Desor_0735Help
Entry
Desor_0735        CDS       T01675                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dor  Desulfosporosinus orientis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desor_0735
  Amino acid metabolism
   00340 Histidine metabolism
    Desor_0735
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Desor_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740897..742177
Genome map
AA seq 426 aa AA seqDB search
MKVENLKDLDLNRLVRKSYGDDEELEARTAAIIKGVQANGDEEIYRLTEKYDHVNLRLQG
LRVSPQEIKDAYQEVSEDFLGALRKAKKNILSFHEKQKRTSWLEPDTDGSMLGQLLLPLK
RVGIYVPGGTASYPSSVLMNALPAVVAGVQKIVMVSPPRKDGTLLPEVLVAADEAGVTEV
YKVGGAQGIAALAYGTETIQPVDKITGPGNIYVTLAKKKVFGTVDIDMLAGPSEILILAD
ESALPQELAADLLSQAEHDRLASAILVSPSRELLEQTIAAVERQLEDLPRAEIARASWDT
YGAAVLVPDLQAGMDLANKIAPEHFELVVKDPYSWLGQVHNVGAVFLGRYSSEPVGDYFA
GPNHVLPTGGSARFYSPLNVDMFMKKVSVIGYSEAALKRDAQEIALLARSEGLEAHARAV
EIRFKD
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgagaatctaaaggatctggatttaaaccggctggtacgtaaatcctatggt
gatgatgaagaattggaggcacgtacagcagcaatcatcaaaggggtgcaagctaacggg
gatgaggaaatctaccggctgaccgagaaatatgaccatgttaacctgcgcctacagggg
ctgcgtgtttcccctcaagaaattaaagatgcttatcaggaagtaagtgaggatttttta
ggggcgctgcgcaaagctaaaaagaatattttaagcttccatgagaagcagaagcgaacc
tcctggctggaaccggatactgatgggagtatgctgggacaactgctgctcccccttaaa
cgggtgggtatttacgttccggggggaacagcttcatatccttcgtcggtgttgatgaat
gctctgccggcggttgtggcaggggttcagaaaatcgttatggtcagtcccccaagaaag
gatggtactcttctgccggaagtcttagtggcggctgatgaagccggagtgacagaagtg
tataaagtcggcggagctcagggaattgctgccttagcctatggtactgaaactattcag
cccgttgataaaataaccggaccgggcaacatctatgtgaccttggccaaaaagaaggtt
tttggcacagtagacatagatatgctcgccggacccagcgaaattttaattttggcggat
gagagcgctcttcctcaagaattggcagcggacctgctttcccaggcagagcatgaccgt
ttagcgtcagcaattttagtttcaccctcccgggaacttttagaacaaactattgctgcc
gtagagaggcagctggaagatctgccccgggcagaaattgcccgtgcttcctgggatacc
tacggagctgccgtcctggtccccgatctccaagcaggcatggatttagccaacaaaatt
gccccggagcattttgaactggtggttaaagacccctattcctggctgggtcaagtgcat
aatgttggtgcggtctttttgggcaggtattcttcagagccggtaggggattattttgcc
ggtcccaaccatgttttgcctaccggcggctcggcccgtttttattccccccttaatgtg
gatatgtttatgaagaaagtaagtgttattggctactcagaggctgccttgaaaagagat
gcccaagagattgccttactggcccgcagtgagggtttggaagcccatgcccgggctgtg
gaaatacgctttaaagattaa

DBGET integrated database retrieval system