KEGG   Desulfosporosinus orientis: Desor_0899Help
Entry
Desor_0899        CDS       T01675                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dor  Desulfosporosinus orientis
Brite
Enzymes [BR:dor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Desor_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917163..917858
Genome map
AA seq 231 aa AA seqDB search
MNKEYRSNDLNGRCAEREWMVHTQLMSRDISDEAVINSMVRVPRHRFVMNDKQELAYYDT
ALEIEAGQTISQPYMVALMAQALKLKASDRVLEVGTGSGYSAGILSQIASRVYTIERHQE
LAKSAEDRLNSLGYNNIEVHVGDGTLGWAEKAPFDAVLVTAGGPVIPDPLLEQLAVGGRL
VIPVGEDRGEQHLLRVKKTVSGKLIKEDLGAVRFVPLIGTEGWNDENGRLS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaagaatatcgtagcaatgatttaaatggacgttgtgcagaacgcgagtggatg
gttcatactcagctcatgagtcgtgatatatcagatgaggcagttattaatagtatggtt
agggttccgcggcataggtttgttatgaatgataaacaagaactggcatattacgatact
gctctggagatagaagcgggacaaactattagtcagccctacatggttgcccttatggcc
caggccttaaagttaaaagcaagtgatagagtcctggaagtgggaacgggttcaggatat
tctgcaggaatactatctcaaatagcatcaagagtttatactatagaacggcatcaggaa
ctagctaagtcggctgaagaccgtcttaatagtctgggctataataatattgaagttcat
gtgggtgacggtactctggggtgggcagaaaaggcgccctttgatgctgttttagtaacc
gcaggcggccctgttattccggatcctttactggagcaattagccgtaggcggtcgtttg
gttattccggttggagaagacagaggagaacaacatttgctgcgtgtgaagaaaacggta
tccggcaaattgattaaagaagatttgggagcggtgcggtttgttccattgattggaact
gaaggctggaatgacgagaatggaaggttaagttag

DBGET integrated database retrieval system