KEGG   Desulfosporosinus orientis: Desor_0982Help
Entry
Desor_0982        CDS       T01675                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dor  Desulfosporosinus orientis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desor_0982
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desor_0982
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desor_0982
Enzymes [BR:dor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desor_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1004345..1005526)
Genome map
AA seq 393 aa AA seqDB search
MEKGYFGEYGGSFVPPQLENALKQLDDAFEKYKDDPDFNQELDYYLRQYVGRPNPLYYAE
KLSKELGGAKIYLKREDLNHTGAHKINNVLGQALLAKRMGVKRVIAETGAGQHGVATATA
CALFDMDCVIYMGEEDTKRQALNVFRMELLGAKVISVTQGTRTLKDAVDAALGDFAQNYE
STFYMLGSAVGPHPFPSVVKHFQAIISREARQQILEAEGKLPDAVMACVGGGSNAIGMFA
NFIVDSSVNLIGVEPAGLGLETGKHAAPLSAGAPGMVHGFKCYVMADEKGEPLPTHSISA
GLDYPGVGPEHSYLKDIGRADYVSITDQESLDAFHRLSRFEGIIPALESAHAVAYALKLA
PTMKPDQIIIVNVSGRGDKDVEQIFNLTNQSKY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggttattttggtgaatatggcggaagctttgtcccgccccagttggaaaac
gctcttaagcagttagacgatgcctttgaaaagtataaggatgaccctgacttcaatcaa
gaactggactattatctccgtcaatatgtgggacgacccaatccgctctactatgctgaa
aagctttccaaagaattaggcggggccaaaatctatcttaaacgtgaggatcttaaccat
acaggcgcccacaaaatcaacaatgttctcgggcaggcgcttctggctaagcgcatggga
gtcaagcgggttattgccgaaaccggagccggacaacacggcgtagccacagcaactgct
tgcgccctctttgatatggactgcgtgatttatatgggcgaagaagacactaaacgccaa
gccctcaatgttttccgcatggagcttctaggcgccaaagtgatctctgttactcaagga
acccgcactctaaaagatgctgtagatgcggcccttggggattttgcccaaaactacgaa
agcactttttatatgctgggctcggctgttggtccccatcctttcccctctgtggtaaaa
cacttccaagcgattatttcacgggaagcccgccagcaaatcttagaagccgaaggcaag
cttcccgatgcggtcatggcttgtgtgggaggcggcagtaatgccatcggaatgtttgca
aatttcattgtagactcaagtgttaaccttatcggagttgaaccggcaggtttaggctta
gaaacgggcaaacacgcagcgcccctttccgccggagcccccggtatggtccatggcttt
aaatgctatgttatggccgacgaaaaaggggagccgctccctacccactcaatttccgcc
ggactggattatcccggggtcggaccggaacacagctatcttaaagatattggccgggct
gactatgtaagtattaccgaccaggagtcacttgatgctttccatagactttcccgtttc
gaagggattatccctgctctggagagcgcccacgccgtcgcttacgctcttaaactggca
cctacgatgaaacctgaccaaattatcatcgtcaatgtatccggacggggtgacaaggac
gtagaacagatcttcaatttgaccaatcaatccaaatactga

DBGET integrated database retrieval system