KEGG   Desulfosporosinus orientis: Desor_1032Help
Entry
Desor_1032        CDS       T01675                                 

Definition
acetyl-CoA carboxylase, biotin carboxyl carrier protein
Orthology
K01571  
oxaloacetate decarboxylase, alpha subunit [EC:4.1.1.3]
Organism
dor  Desulfosporosinus orientis
Pathway
Pyruvate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dor00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1050115..1052013
Genome map
AA seq 632 aa AA seqDB search
MRPVKITDTTLRDAHQSLWATRMRTEDMLPILTELDEAGFFSLEVWGGATFDVCLRFLGE
DPWVRLRQIKSRVKKTPLQMLLRAQSLVGYQHYPDDVVREFVKLSVKNGIDIIRIFDALN
DVRNMVVPMEAAKKAGAHVQASVVYTISPVHTTKHYLETATALAELGADSICIKDMAGLL
TPLKAYELVSLLKKELGIMVHLHSHYIGGMAVGTYLKAAEAGVDVVDTASVPLAFGASQP
PVETVVRAFQETDFDSGISLRKLFHIAKYFESLRKSRGFERGITRISDMRVFEHQVPGGM
ISNLVSQLEEQGALDRIHDVLEEIPKVRAELGYPPLVTPTSQIVGTQAVLNVLSGARYKL
VPGEVKGYVRGLYGRPPASIDLEIQKKIIGDDEPMSVRPADLLDPGMAKAKQDSLNLAQS
EEDVVSYALFPQIAKKFFEEREKGIITREETQDRKAKKDIKETLTGLLSKEDSKLNLQEI
KELIQIIDETEISELNLESDGVKIAIRKGTGVPAGIPVVSVPRQDAVPAVSAAAPVPPSV
EVPVKTQEPVFNENTETITSPMVGTFYAAQSPEADPYVKVGQVIEVGQPVCIVEAMKLMN
EIESEVAGKVLQILVENGQPVEYGQPLFVIEK
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
ttgagaccggtcaaaattacggatacgactttgagggatgctcaccaaagcctttgggca
actcggatgcgtacagaagacatgctgccgattctaacagagctggatgaggcagggttt
ttctctctggaagtatggggaggagcaacctttgatgtgtgtttgcgctttttaggcgaa
gacccttgggtacgtttgaggcagattaaaagtcgggtgaaaaaaactcctttgcagatg
ttgttaagggcccagtcattagttgggtatcagcattacccggatgatgttgtgcgagaa
tttgtgaaactgagcgttaaaaatggaattgacatcattcgaatattcgatgccttaaat
gatgttcgaaatatggtagttcctatggaggcagctaagaaagcaggagctcatgttcaa
gcatctgttgtttataccattagtccggttcacacaacaaagcattatttggaaacagcc
acagcattggctgaacttggtgcagattccatatgtattaaagatatggcaggtctgctt
actcccttgaaagcttatgaattggtgtctttgttgaaaaaagaactaggaatcatggtt
catttacacagccattatatcggcggaatggcagtaggtacttacttaaaagctgcagaa
gcaggtgtggatgttgtagatacggctagcgttcccttagcctttggtgcaagtcagcca
ccagttgaaactgttgtccgggcattccaagagaccgattttgattcaggaattagtttg
cgaaaactcttccatattgccaagtattttgaatcattgcgtaaaagccgtggctttgag
cgcggtattactcgcatctctgatatgagggtattcgaacaccaggtcccgggaggcatg
atctccaatctggtatcccagttggaagagcaaggagcattggaccgtattcatgatgtt
ttagaggaaattcccaaagtgcgtgctgaattaggatatccgcctttggtaactccaacg
agtcaaattgttggaacgcaagctgtattaaatgttttgagcggggcaagatataagtta
gtgcctggagaagttaagggatatgttcgtgggctttatggccggccaccagcttctatt
gacttagagattcaaaagaaaatcattggtgatgatgagccaatgtcggtcagaccggca
gatcttctcgatcctggtatggctaaagccaaacaagatagtcttaacttagcccaatcg
gaagaagatgtcgtcagctatgcactttttccgcaaatagcaaagaagttttttgaagag
cgggagaagggcattatcacaagagaagaaacccaagaccgaaaggcaaaaaaagatata
aaagaaacacttactggactgttatctaaggaggattcaaaattgaatttacaagaaatc
aaggaactcattcaaattatagacgaaacggaaattagtgaattaaatcttgaaagtgat
ggcgtgaaaatcgcaattcgtaaaggtacgggtgttccggccggcattccggtagtgtct
gttcctcgccaagacgctgtcccggcagtgagcgcagcagcacctgttcctcccagtgtt
gaagtcccggtcaaaacacaggaacctgtttttaatgagaacacggagactataacctct
cctatggttgggacgttctatgctgcacaatctccagaagcagatccctatgtcaaagta
ggacaggtgattgaggtaggtcaaccggtctgtatcgtcgaagctatgaagctaatgaac
gaaatcgaatcagaagtcgccggaaaagtccttcaaattcttgtagaaaacggtcagcca
gtagaatatggacaaccgctgttcgtcattgaaaaataa

DBGET integrated database retrieval system