KEGG   Desulfosporosinus orientis: Desor_1169Help
Entry
Desor_1169        CDS       T01675                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dor  Desulfosporosinus orientis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desor_1169
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desor_1169
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desor_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1190671..1192362
Genome map
AA seq 563 aa AA seqDB search
MFIYRINMTDKTFIKEEVSQRYKHLGGRGFTSLLLSDELDPKSSPLGDENKLVIAPGLLT
GTIAPSSGRTSIGAKSPLTGTIKESNAGGTAGQYLAGHNIKALIIEHLPKDKEDSSIIIV
EKNNLRLEVRNNLRGLGNYDTVANLRSEFGDQCSIISIGPAGEVGSAMATIAFSDPEGRP
SRHAGRGGLGAVMGSKGVKAIVISKSNDSVPEPRDKTRFLEIVKKFSLELYQTKKGLRDY
GTALLVNAINAVGGLPTRNFSMGYNDQAEEFSGERLNQLCNERKGQTGHACSRGCAVRCS
NVFNNGQGDYVTASLEYETIALLGSNCGINNLDEIAQLDRLCDDLGLDTMETGVSLGVAM
EGGALQFGHFEQMKEAINDIVTGVKIGRIIGQGAVATGRILKVSRVPAVKGQGLSAYDPR
ALKGTGVTYATSPMGADHTSGNCLPGRGGLKPYEDNGQVDLSKNLQIITMICDFLGICIF
VGPVQENMPVFSALASSFTGEEINEEKLYDLARSILEKEVEFNVLAGIDNEQNDLPRFFR
EEPLPNNGYFFDIPAEELKNFKY
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
ttgtttatttatagaattaatatgacagataaaacgtttataaaagaagaagtgtcccaa
agatataaacatttaggtggaagaggatttacttcgcttttacttagtgatgaactggat
ccgaaatcttctccccttggagatgaaaacaagctggtaatagcaccggggctgttgact
ggtacaattgctccatcatcagggcgcacttccattggggctaaaagtcctttaactgga
accatcaaagagagtaatgcaggaggaactgcagggcagtatttagcgggtcataatatt
aaagctttgataatcgaacatcttcctaaagataaagaagattcttcgattattatcgta
gaaaaaaataatttaagattagaagtcagaaataacctaaggggattgggaaattacgat
accgtagctaatctacgaagtgaattcggagatcagtgttcgattatttcgattggtcct
gctggtgaagtggggtcagctatggcaacaatagcattcagcgatcctgaaggaagacca
tcaaggcatgccggaagaggcggcttaggtgctgtgatgggaagtaaaggtgttaaagca
attgttattagtaaatcgaatgattctgttcctgaaccccgggataagacgagatttttg
gaaatcgtcaagaaattttcgcttgaattatatcaaactaaaaaaggacttagagattat
ggaaccgctttattagttaatgccattaatgctgtaggagggttaccgactcgtaacttt
agtatgggatataatgaccaagctgaagagtttagtggagaaaggcttaatcaattatgt
aacgaaagaaagggacaaaccggacatgcctgttcaagaggttgtgcagtacgatgttcc
aatgtctttaataatggccaaggcgattatgtaaccgcgagtttagagtatgaaacgatt
gccttgttaggttcgaattgtggaatcaataatctagatgaaattgctcagttagacaga
ctgtgcgatgatctgggtttggatacgatggagacgggtgtaagtttgggtgttgctatg
gaagggggtgctttgcaatttggtcattttgagcaaatgaaagaagctattaatgatatc
gtaacaggggttaaaataggccgaatcattggacagggagctgttgcaacagggagaata
ctaaaggttagcagagttcctgcggttaaaggtcaaggattatcggcatatgatccgcga
gctttgaagggcactggagtaacttatgctacctcgcctatgggagcggatcatacttcc
ggcaactgcctgccaggacgcggaggattaaaaccttatgaagataatggtcaagttgat
ctatcaaaaaatttacagatcataaccatgatctgcgatttcctggggatttgtattttc
gtcggaccagtacaagagaatatgccagtattttcagctttagcaagctcctttactggc
gaagaaataaatgaagaaaagctatatgatctagcccgttcgatcctagaaaaagaagtt
gaatttaatgtattagcaggaatcgacaatgaacaaaatgatctgcctaggttttttaga
gaagaacctttgcctaacaatggatacttttttgatataccagcagaggaattaaagaat
tttaaatactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system