KEGG   Desulfosporosinus orientis: Desor_1312Help
Entry
Desor_1312        CDS       T01675                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dor  Desulfosporosinus orientis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desor_1312
Enzymes [BR:dor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Desor_1312
Exosome [BR:dor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desor_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358448..1359425
Genome map
AA seq 325 aa AA seqDB search
MELKRRPRRLRANETIRSMVRENHIRIENLIYPMFVMPGEKQKVEVSSMPGVYNFSLDEF
IIALKEVVELGVPAILLFGIPESKDSVGSGAYHEHGIVQQAVRLAKQHYPDLYVVTDVCL
CEYTDHGHCGLIENGQILNDPTLKLLANTALSHAQAGADMVAPSDMMDGRVAAIRETLDK
EGFSHIPIMAYSAKFASGFYGPFREAAGSTPQFGDRKTYQMDPANGDEAMLETELDIEEG
ADMIIVKPALSYGDIIYRTKQKYGIPLAAYNVSGEYAMVKAAAEKGWIDEKRIVMEALLS
MKRAGADLLITYHALDVARWLREEI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaagaggcgcccccggcgtttacgggccaatgaaaccattcgcagcatggtt
cgggaaaaccacatccgaattgagaacttaatctaccccatgtttgtaatgccgggagaa
aaacaaaaagtagaagtttcttctatgcccggagtctataatttttcactggatgaattt
atcatagcccttaaggaggttgtggaactgggagtccctgctattctgctcttcgggatt
ccggaaagcaaggatagtgttggttccggcgcctaccatgagcatgggatagtgcagcaa
gctgttcgcttggcgaaacagcattatccggatctctatgtcgtcacggacgtctgcttg
tgtgagtatacggatcatgggcattgcgggctgatagagaatgggcaaattctcaacgat
ccaactcttaagctcctggccaatacggctctttcccatgcccaagctggtgccgatatg
gttgctccctccgatatgatggatgggcgagttgccgccattcgcgaaactctcgataag
gaaggattttcacatattcccatcatggcttactcagccaaatttgcttccggattttat
ggaccttttcgggaagctgccggatcaacgccccagttcggagatcggaaaacctatcag
atggaccccgccaacggcgatgaggcaatgttggaaacagaattggacattgaagagggc
gccgacatgattattgttaagccggctttgtcctatggtgatattatttatcggactaaa
caaaaatacgggattcccttagcagcctataatgtcagcggagaatacgcaatggttaaa
gcagctgcagagaagggctggattgatgagaaacgaatcgttatggaggctctgctgagt
atgaaaagggcaggtgcggatttgctgattacctatcacgctttggatgtagcacgttgg
cttagagaggagatttaa

DBGET integrated database retrieval system