KEGG   Desulfosporosinus orientis: Desor_1465Help
Entry
Desor_1465        CDS       T01675                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dor  Desulfosporosinus orientis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desor_1465
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desor_1465
Enzymes [BR:dor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Desor_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1532305..1533096
Genome map
AA seq 263 aa AA seqDB search
MILDEIVNYTKGRVQALKEAKPMEEIIKAALGTEKKHSFAFAKALAGEGMAFICEVKKAS
PSKGIISERFPYLEIAQAYEQAGANAISVLTEPHFFLGSDQYLKDIKAQVNIPVLRKDFI
IDPYQIYEAKVIGADAVLLICSLLDLKTLKDYLQLVESLGLSALVETHTEEEIDRALEAG
AAIIGINNRNLKTFEVDLQTTISLRRHVPKDKILVSESGIKTAEDMERLRHSQVDAVLIG
EAFMRQEDKAALMRNLQSSEEEA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatgagattgttaactatacaaaaggaagagtccaagccttaaaagaggct
aagcctatggaggaaatcatcaaggcagcccttggcacggaaaaaaaacattcctttgcc
tttgcaaaggccttggccggtgaggggatggccttcatttgtgaagtgaagaaagcttcg
ccttctaaagggatcatcagcgaaaggttcccttatctggagattgctcaagcctacgag
caggcaggggccaatgcgatttccgtattgacggaaccacattttttcctgggcagtgat
cagtatttaaaagatataaaagctcaggtgaatattcctgtgctgaggaaggactttatc
atagatccttatcagatttatgaggcaaaggtcataggagcggatgcagtactgttgatc
tgcagcttgctggatttgaagacccttaaggactatcttcagctggtggaaagcttgggg
ctttcagctttggttgagacccatactgaggaggaaattgatcgggccttagaagcgggg
gcagccatcattggcattaacaacagaaacttaaaaacctttgaggttgatttgcagaca
accatttccctccgccggcatgtgcctaaggataaaattttggtgtctgaaagcggtatt
aagacagcggaggatatggaacgcctgcgccatagccaggttgatgccgtattaattggc
gaagcttttatgcgccaggaggataaggcagccttaatgagaaacttgcaaagcagcgag
gaggaggcttag

DBGET integrated database retrieval system