KEGG   Desulfosporosinus orientis: Desor_1465Help
Entry
Desor_1465        CDS       T01675                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01130  Biosynthesis of antibiotics
dor01230  Biosynthesis of amino acids
Module
dor_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desor_1465
Enzymes [BR:dor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Desor_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth Amidase_3
Motif
Other DBs
NCBI-ProteinID: AET67122
UniProt: G7WAR1
Position
1532305..1533096
Genome map
AA seq 263 aa AA seqDB search
MILDEIVNYTKGRVQALKEAKPMEEIIKAALGTEKKHSFAFAKALAGEGMAFICEVKKAS
PSKGIISERFPYLEIAQAYEQAGANAISVLTEPHFFLGSDQYLKDIKAQVNIPVLRKDFI
IDPYQIYEAKVIGADAVLLICSLLDLKTLKDYLQLVESLGLSALVETHTEEEIDRALEAG
AAIIGINNRNLKTFEVDLQTTISLRRHVPKDKILVSESGIKTAEDMERLRHSQVDAVLIG
EAFMRQEDKAALMRNLQSSEEEA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatgagattgttaactatacaaaaggaagagtccaagccttaaaagaggct
aagcctatggaggaaatcatcaaggcagcccttggcacggaaaaaaaacattcctttgcc
tttgcaaaggccttggccggtgaggggatggccttcatttgtgaagtgaagaaagcttcg
ccttctaaagggatcatcagcgaaaggttcccttatctggagattgctcaagcctacgag
caggcaggggccaatgcgatttccgtattgacggaaccacattttttcctgggcagtgat
cagtatttaaaagatataaaagctcaggtgaatattcctgtgctgaggaaggactttatc
atagatccttatcagatttatgaggcaaaggtcataggagcggatgcagtactgttgatc
tgcagcttgctggatttgaagacccttaaggactatcttcagctggtggaaagcttgggg
ctttcagctttggttgagacccatactgaggaggaaattgatcgggccttagaagcgggg
gcagccatcattggcattaacaacagaaacttaaaaacctttgaggttgatttgcagaca
accatttccctccgccggcatgtgcctaaggataaaattttggtgtctgaaagcggtatt
aagacagcggaggatatggaacgcctgcgccatagccaggttgatgccgtattaattggc
gaagcttttatgcgccaggaggataaggcagccttaatgagaaacttgcaaagcagcgag
gaggaggcttag

DBGET integrated database retrieval system