KEGG   Desulfosporosinus orientis: Desor_1561Help
Entry
Desor_1561        CDS       T01675                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00480  Glutathione metabolism
dor00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Desor_1561
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Desor_1561
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Desor_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AET67211
UniProt: G7WD16
Position
1641575..1642117
Genome map
AA seq 180 aa AA seqDB search
MSIYDYSFQAIEGNEVAMSEYKGKVLLLVNTASKCGFTPQYEGLEKLYKSYKDRGLEVIG
FPCNQFAEQEPGTNSEVQEFCKVRYGVTFPLSAKVDVRGENAEPMFKFLAENTEFKGFGK
GVKNKALELMLKQKYGKGFSDSSIKWNFTKFLIDRRGNIAGRFEPTVTPESMTAVIEECL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgtccatttatgattattcctttcaggctattgagggaaatgaggttgccatgtccgag
tataaaggaaaagtactgctcctcgtcaacactgccagcaaatgcggttttactccccag
tacgagggcttggagaagctgtataaaagctataaagaccggggacttgaggttattggc
tttccctgcaatcagtttgccgaacaggagccggggaccaacagtgaggtgcaggagttc
tgtaaagtaagatacggagttacttttcccctgtcggcaaaagtggatgtgagaggtgaa
aatgccgagccgatgtttaaattcctggctgaaaatacggagtttaagggttttggcaaa
ggtgtaaaaaacaaggccctggaactcatgctcaaacagaaatacggaaaagggttctcc
gattcgtcgattaaatggaattttactaagtttcttatcgataggaggggtaacatcgcc
ggccgttttgaacccacggtaaccccggagagcatgacagctgttattgaggagtgctta
taa

DBGET integrated database retrieval system