KEGG   Desulfosporosinus orientis: Desor_1710Help
Entry
Desor_1710        CDS       T01675                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dor  Desulfosporosinus orientis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dor00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1804413..1805069
Genome map
AA seq 218 aa AA seqDB search
MNPLLKARQEIVIKGKEILATKLTVGTWGNISCRVPGENYIAITPSGMSYETLVPEDIVI
IDLNGNIASGTRKPSVEVPLHMAIYSAREDVQAVIHTHSAYASAMAVARKEIPGAVEDLV
QIVGGNVRVNEYALPGTEQLGKKTVKALEGRNAVLLANHGVLGVGRDLNEALKVCQVVEK
SAQIVLLAQLIGGAVELSQEDIDGMRSFYLNGYGQSKS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgttgttgaaagcccgccaagagatagtgatcaaaggcaaagaaatattagcc
accaaactcactgtcggaacttggggtaatattagctgtcgagttccgggggaaaactat
atagccattacgccatcaggtatgagttatgaaaccttagtacctgaggatatcgtaatt
atagacctaaatggcaatatcgccagcggtacccgcaaaccttctgtagaagttccttta
cacatggcaatatattctgctcgcgaggatgtccaggctgttattcatactcatagtgcc
tatgcaagtgcaatggctgtcgcgagaaaggaaattccaggtgctgttgaagatttagta
caaattgtcggcggcaatgtgagagtaaatgagtatgctttgccgggaacggagcagctg
ggcaaaaaaacggttaaagctttagagggcaggaatgccgtattgctggcaaatcacgga
gtactgggggttggccgtgatttaaatgaagccctaaaagtttgccaagtggttgaaaaa
tcggcgcaaattgtcttgctggcccagcttataggtggtgcagtggagttgtcacaagag
gatattgacgggatgcgcagcttttatctgaacggatacgggcaaagcaaaagctaa

DBGET integrated database retrieval system