KEGG   Desulfosporosinus orientis: Desor_2280Help
Entry
Desor_2280        CDS       T01675                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dor  Desulfosporosinus orientis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desor_2280
Enzymes [BR:dor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Desor_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2381986..2385465
Genome map
AA seq 1159 aa AA seqDB search
MELKAYHNSHDLYYRKPFGAVHCGERIRFRFQISSSVPIQGCFLHLREEDWERSVPMSRI
SEGLELETELELESEGAGESGCFYETELEVMDGTGLVWYYFVINTESGTYYYGNNRDKLG
GEGCLGKEVPLAYQITVSKPAEVPRWYRRGIMYQIFVDRFFKHLDKGFLDDSRPNALLHA
NWYDDPVYIKDEQGRVTDWDFFGGTLQGIIDKLPYFEELGVSILYLNPIFEAASNHKYDT
ADYLKIDPRYGDERTFAKLTAAAKEYGISIILDGVFSHTGADSIYFNKYNNYPELGAFQS
PDSPYYSWYKFKSGQEYAGWWGVDSLPEVEEMTPSYRNFIYGGENSVVQQWLNLGAAGWR
LDVADELPDEFIKELRQALKQVNSEAVLIGEVWEDASNKVSYGQRRRYFGGEELDAVMNY
PFRASFLGFILNQTDAGTLWREMMSIFENYPRENFYGAMNLLGSHDTRRILTLLGEAPPE
QTLTSAEQRRFRLAGDARDLGIQRLRLLSLIQVAWPGVPCIYYGDEVGLEGYADPYNRGT
YPWGRENQEILQWYQRILRMRREYDLLQTGDFQPFFCDADVFGFSRAGTEETLTVLVNRH
QGESKTVKFEAGMDSPELVVDLLTGEKLSPEELAALSVPALSAKALLTMKTQPHQLRLNR
SCGILLHISSLPSSWGLGDLGKEAYDFIDFLGAAGQSLWQVLPLNPSGAGGCPYQSASVF
AGNTMFISLDHLIYEGLLDLRKTQEKYRQLKSLGLRESLLKQAFQELKNNLLHEAYLEFR
QRLKLVPNPLSQTTDSKYLSPENYGEFQRENKAWLEDFSLFRALKAHFDEAPWYAWEAGI
ARREPEALAKYTSLLQEERDFITFLQYTFFYEWDLLKEYAAGKGVRMIGDLPHFVAEDSC
DVWVNRNLFKLSTGGRAAKIAGVPPDYFSKTGQLWGNPVYDWDELKKTDYAWWKMRLKFG
LKQFDYLRLDHFRGFEAFWEVEAGEETAEKGRWMKGPGKDFLASLIAAFGQCPFIVEDLG
IITPEVRTLKHIFGLPGVKVLQFSPLAEMSEDEDWNLVYYTGTHDNNTLLGWYSGLQPGT
VPPAGDKGQACYQVIEELYSSQAAWVIVPMQDILGLGEEARMNVPGKVHGNWKWQLEEDT
DLKEVTESLHNLAVTRGRV
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atggaattgaaagcctatcataattctcatgatttgtattatcgcaaaccttttggtgcg
gttcattgcggggagagaatacgatttcgtttccagatcagttcctctgtgcctattcaa
ggctgctttctgcacctgcgggaggaggattgggaaaggtctgttcctatgagccggatc
agtgaggggctggagttagagacagagttggagttggagtctgagggcgctggggagtct
ggctgtttttatgaaacagagctggaagttatggatggcacggggcttgtttggtattat
tttgtgattaatacagagtccgggacttattattatggcaataaccgggataagctgggg
ggagagggctgtctggggaaagaggtgcctcttgcttatcagattacggtttctaagccg
gcggaggttccccgctggtaccggcggggaattatgtatcaaatctttgtggatcgcttt
tttaagcatttagataaaggtttcttagatgattcgaggcctaatgctttgctccatgcc
aactggtatgatgatcctgtttatattaaggacgagcagggcagggtgacggattgggac
tttttcggaggtactttgcagggaattatcgataagctgccttattttgaggaattagga
gtcagtattctttacctgaatcctatctttgaggcggccagcaatcataagtatgatacg
gcggattatttgaaaatcgatcccaggtatggagacgaaaggacctttgccaagttaact
gccgctgctaaggagtatgggatttcaatcatcctggacggtgttttcagccatacgggg
gcggatagtatttacttcaataaatataacaattatccggagctgggggctttccagtcg
ccagattctccttattattcctggtataagtttaaatccggtcaggagtatgcaggatgg
tggggtgtggattccctgccggaagttgaagaaatgactccttcttaccggaattttatt
tacggcggcgaaaacagtgtggttcagcagtggctgaacctgggagccgccggctggaga
ttagatgtggcggatgagttgcctgatgagtttattaaagagctgaggcaagccctgaag
caggtgaattcagaggcggttttaattggggaagtgtgggaagacgcctccaacaaggtg
agttatggccagcgccgccgctatttcgggggagaggaactggatgccgtcatgaactat
cctttccgggcaagcttcctgggctttatcctcaaccagacggatgccgggactctttgg
cgggaaatgatgagtatctttgagaattatccccgggaaaacttctatggggcgatgaat
ttactgggcagccatgataccaggcgtattttgactctcttaggagaagctcctccggaa
cagaccttgacctctgcggagcagagacggttcaggcttgctggggatgcccgggatctg
gggatacaaagactcaggcttttaagcttgattcaggtggcatggccgggagtgccttgt
atttattacggagatgaagttggcctcgagggctatgcagatccttataaccggggcacc
tatccctggggccgggagaatcaagaaatcctccagtggtaccagcggattttgcggatg
cgcagggaatatgacctgctgcaaaccggggattttcagcccttcttttgcgatgctgat
gtttttggcttctcccgggccggcactgaggaaaccctgacggtactggtcaaccggcat
caaggggagagcaaaaccgtgaaatttgaggcaggaatggattcccctgagttagtggtg
gatctgcttaccggggaaaagctttccccggaagagctggctgctttgtctgttccggct
ctgtctgccaaggccttgctgactatgaaaacccagcctcatcagctgcggcttaaccgt
tcctgcggaatattgctgcatatcagttccttgccttcctcctggggactgggggactta
ggcaaggaagcttatgatttcatagatttcttaggagcagccggtcaatccttgtggcag
gtactccctttgaatccgtcgggagcaggagggtgtccctatcaaagtgcgtctgtcttt
gccgggaataccatgtttattagtttggatcatttaatctatgagggactattggattta
cgaaagacccaggaaaaataccggcagttaaagagcctgggtttaagggaaagcctcttg
aagcaggcttttcaagaactgaagaataatttgctccatgaggcctacctggaattccgg
caaagactgaaattagttcccaatcccttgtcccagacaacggattccaagtatttatcc
ccggagaattatggtgagtttcaaagagagaacaaggcctggctggaagacttcagcctt
ttccgggctctcaaggctcactttgacgaagctccctggtatgcctgggaagctgggatt
gctcgccgggagcctgaggccttagctaaatacacctctctcctgcaggaagagagagac
tttatcacctttttgcagtatactttcttttatgaatgggatttgctgaaagaatacgcg
gcagggaaaggagtccgcatgattggggatttgcctcattttgtcgcagaggacagctgt
gatgtttgggtaaatcgaaatttgttcaaactgagtacaggggggagagccgccaaaatt
gccggagtacctcccgattatttcagcaaaaccggtcagttatggggcaacccggtctat
gattgggatgagttaaagaaaacggactatgcctggtggaaaatgcgccttaagttcggc
ttaaaacagtttgactacctgcgcttggatcattttcgcggctttgaagccttttgggaa
gtagaggcgggtgaggaaacggcggaaaagggcaggtggatgaaaggcccggggaaagat
ttcctggccagcttaatagctgcattcggccagtgtccttttatagtagaagatttagga
attattacgccggaagtccggactttaaaacacatcttcggcctgccgggggttaaagtc
ctgcagttcagtcctttggcagagatgtctgaggatgaggattggaatctggtgtattac
acaggaacccatgacaacaataccctgctgggctggtacagcggcttgcagccgggcacg
gtgccgccggcgggggataaggggcaggcttgttatcaggttatcgaggagctctactcc
agccaggcagcctgggttatcgttcccatgcaggatattttaggcctgggggaagaggcg
cggatgaatgtccccggcaaagtccatggcaattggaaatggcagcttgaggaagatacg
gatctgaaggaagtgactgaatcactgcacaacctggcggtaacccggggcagagtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system