KEGG   Desulfosporosinus orientis: Desor_2516Help
Entry
Desor_2516        CDS       T01675                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dor  Desulfosporosinus orientis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dor01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dor00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2589388..2591391
Genome map
AA seq 667 aa AA seqDB search
MPFGYMGKILWVDLTTGTLQEEEIQDSLYNKFLTGYGLGAKIIFDKLQPGIDPLSPENIL
GMMSGLLTGSGAFFSGRWMIMGKSPLTNTWGDANCGGYFAPAIKSSGYDGIFFVGKSEKP
VYLLIDGDRKALIDATYLWGMDSNDTIDDLTNRYGAHFKTACIGPGGEKMARISGVVTDK
GRLAARSGLGAVMGSKNLKAVCLGGNKNVNIFDVQTITKLTDDFAEQFYTYKHPLKDKML
NEAANMPILSGVVRILSENNMLPISGEPEKYAMKTWGTSGTVAYSANIGDSPVKNWKGVG
YIDFPGRLTHEISNDSVTKYETDKYGCYSCPLCCGGKVTVKEGPYPISETHKPEYETICG
FGTMLLCNDMPSIIKINDLLNRAGIDTISCAATVAWAFEAYENRVITSADTDGLELTWGN
NEAAIKLVEKIAKGEGVGRYFMNGVKFASEHFGKDSEAYAMHVEGQELPMHDPRNPDGMG
LGVGYEAEPTPGRHTSTLDCCDLYRPAQPSNKLKDKNLHPMKNKCTDADPGVKLRDASCF
MDLINGLGLCAFAFDTEVTPPIVEWTNAMTGWNLDFEEYLNIGRRIKTLRHSFNIREGIN
PKEFKMPDRARGIPPLEKGPNAKIQNDFEKGKINYFKAMGYDIKTAKPLAETLDMLDLPE
VKKALYK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgccatttggctacatgggaaaaatactatgggtagacctgactacaggaaccttacag
gaagaggaaatacaagatagcctttacaataagtttttaacaggttatggtttgggagcg
aaaataatatttgataaactgcagccagggatagatccgttgagtcctgaaaatatttta
ggtatgatgagcggcctcttaaccggctctggtgcatttttctctgggcgttggatgatt
atggggaaaagtccgctaacaaatacttggggcgacgccaactgtggaggatattttgct
ccggcaataaagtcctccggatatgatggtatattttttgtgggtaaaagtgaaaaacct
gtttatttactgatagacggtgatagaaaagcgctcatagatgccacttatttatgggga
atggattctaatgatacgattgatgatttaactaatagatatggcgctcactttaaaaca
gcttgcatcggaccgggcggtgaaaaaatggccaggatttccggtgtcgtaactgataaa
ggaaggttggctgcaagaagtggattaggggcagtaatgggttcgaaaaacttaaaagca
gtatgccttggtggtaacaagaacgtcaatatttttgacgtgcagacgataactaaattg
acagatgattttgccgagcagttttatacttacaaacatcctctgaaagacaaaatgtta
aatgaagcggcaaatatgccgatattatcaggcgttgtacggattctaagcgaaaataat
atgttgcctattagtggagaacctgaaaaatacgctatgaaaacatggggaacatccggc
acagtagcttactcagccaacattggtgattccccggttaaaaactggaaaggtgtcggt
tatatcgattttcctggaaggttaacccatgaaatttccaacgattcggtaactaaatat
gaaactgacaagtatggctgctacagctgtccactttgttgcggtggaaaagtaactgta
aaagaaggtccatatcctatttcagaaacccataagcctgagtatgagacgatttgcggc
tttgggacaatgctgctctgcaatgatatgcctagtattatcaagattaacgatctcttg
aaccgtgccggtattgacacaatcagttgtgctgctactgttgcatgggcttttgaagca
tatgaaaatagagtaatcacctccgctgatacggatggtttggagttaacctggggtaat
aacgaagcggctataaaattggtagaaaaaattgcaaaaggggaaggcgtaggaaggtac
ttcatgaacggcgtcaaattcgcatccgaacattttggaaaagactcagaagcatatgct
atgcatgtggaaggacaagaattgccgatgcatgacccacgtaatcccgatggcatgggt
ctaggagttggatatgaagcggagcccacaccaggtagacataccagtacgctggactgc
tgcgatttgtatagacctgctcaaccgagcaataagttaaaagacaagaaccttcatccg
atgaagaataagtgtacggatgcagatccgggtgttaaattgagggatgccagctgcttt
atggatcttatcaacggtttggggctttgtgcctttgcttttgacacagaagttacacca
cctatcgttgaatggactaacgcaatgacaggatggaacttagactttgaggaatacctg
aacatagggcgaagaataaaaacccttcgtcattcatttaatattcgtgaaggcataaac
cctaaggagtttaagatgcctgatagggcaaggggcatccctcctttagagaaaggtccc
aacgcaaagattcaaaatgattttgaaaaaggaaagataaactattttaaggccatggga
tatgacataaaaactgccaaaccgcttgctgaaacacttgatatgctggatttacctgag
gttaagaaagccttatacaagtaa

DBGET integrated database retrieval system