KEGG   Desulfosporosinus orientis: Desor_2958Help
Entry
Desor_2958        CDS       T01675                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00071  Fatty acid degradation
dor00280  Valine, leucine and isoleucine degradation
dor00281  Geraniol degradation
dor00310  Lysine degradation
dor00360  Phenylalanine metabolism
dor00362  Benzoate degradation
dor00380  Tryptophan metabolism
dor00410  beta-Alanine metabolism
dor00627  Aminobenzoate degradation
dor00640  Propanoate metabolism
dor00650  Butanoate metabolism
dor00903  Limonene and pinene degradation
dor00930  Caprolactam degradation
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Desor_2958
   00650 Butanoate metabolism
    Desor_2958
  Lipid metabolism
   00071 Fatty acid degradation
    Desor_2958
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desor_2958
   00310 Lysine degradation
    Desor_2958
   00360 Phenylalanine metabolism
    Desor_2958
   00380 Tryptophan metabolism
    Desor_2958
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Desor_2958
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Desor_2958
   00281 Geraniol degradation
    Desor_2958
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desor_2958
   00627 Aminobenzoate degradation
    Desor_2958
   00930 Caprolactam degradation
    Desor_2958
Enzymes [BR:dor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Desor_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AET68484
UniProt: G7WGP8
Position
3046467..3047234
Genome map
AA seq 255 aa AA seqDB search
MNVFTEKKGNICTVIINRPEVRNAVDAETAGQLAEAFRVFDTDDSLKVAVLWGAGGNFCA
GADLKAISKGKMNQMDPDMSKDGPMGPTRMRLSKPVIAAVSGYAVAGGLELSCWCDLRVV
ERDAAFGVFCRRFGVPLVDGGTQRLPRLIGLSRAMDMILTGRTVNGEEAFAMGLANRLVE
PGTSRQEAENLAALLAGFPQNCLRSDREAVYRGFDINFDAALKLEFEMGLKVVQSGETLK
GATSFAGGVGRHGQV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtatttactgaaaaaaaaggcaacatctgcacagtcataataaaccgtcctgag
gttaggaatgcggtggatgccgagacagctggacagctcgcggaagcgttcagggtcttt
gatacggatgatagtctgaaggtggcagttttatggggggctggcggcaatttttgcgcc
ggtgccgatcttaaggctatttccaaaggaaaaatgaaccagatggacccggacatgtcc
aaggacgggccgatgggaccgaccaggatgaggctttccaagcctgttattgccgcggtg
tccggctatgccgtggcaggaggtcttgagctttcctgttggtgcgacctgagagttgta
gagagggatgctgcattcggagttttttgccgccgttttggagtgccccttgttgacggg
ggtactcagcgcctgccacgacttataggcttgagccgggccatggatatgatccttaca
ggacgaacagttaatggcgaggaagcctttgccatgggcttagccaaccgacttgtggaa
cccggcacctcaaggcaggaggcagaaaatctggccgctctgctggcggggtttccccaa
aattgcctgcgcagtgatcgggaggcagtttaccgcggttttgatatcaattttgatgcc
gccttgaaactagaatttgaaatgggcttaaaagtggtgcaaagcggggaaaccctgaaa
ggggccacctcttttgccggcggggtgggtcgtcacgggcaggtttga

DBGET integrated database retrieval system