KEGG   Desulfosporosinus orientis: Desor_3357Help
Entry
Desor_3357        CDS       T01675                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dor  Desulfosporosinus orientis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desor_3357
   01230 Biosynthesis of amino acids
    Desor_3357
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_3357
   00030 Pentose phosphate pathway
    Desor_3357
   00051 Fructose and mannose metabolism
    Desor_3357
   00052 Galactose metabolism
    Desor_3357
  Energy metabolism
   00680 Methane metabolism
    Desor_3357
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desor_3357
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desor_3357
Protein phosphatases and associated proteins [BR:dor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desor_3357
Messenger RNA biogenesis [BR:dor03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desor_3357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3483869..3484837)
Genome map
AA seq 322 aa AA seqDB search
MSRVVQRIGVLTSGGDAPGMNAALRAVVRKGIYHGVKVYGISRGYEGLIHGEIQEMSIGS
VADIVLRGGTLLKTARSQEMMTPEGQQKALDQLHKHQIDALVVIGGDGSFRGAQTLARGI
QIVGIPGTIDNDIPGTDLTIGFDTAVNTVIDAVSKIRDTATSHERTFIVEVMGRDCGNIA
LQAGIACGAESILVPEIPYDLEEICDKLKRGHQRGKNHSIIIVSEGVGKAYEIGEELRSR
TGFETRITILGHLQRGGNPSALDAVIAASMGGKAVEIILANETNKMTAYVNQVVVSRPLD
VAYGERRPFNQDLYELANQLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagagtagtgcaaaggattggagttctaaccagtggaggagatgctcctggaatg
aatgcagcccttagagcagtggttagaaaagggatttatcatggagttaaagtttatggg
ataagcagaggatatgaagggttaatccatggcgaaattcaagaaatgagtattggatct
gttgcggatattgtcctgcggggaggtactttgctgaaaaccgcaagaagccaggaaatg
atgactccggaggggcagcaaaaggctttagatcagctccacaagcatcaaatagacgct
ttagtagttatcggaggggatggttccttcaggggtgcacaaacactggctagaggaatc
cagattgtgggaattccgggcactattgataacgatataccgggtacagatttgaccatt
ggatttgacacggctgtcaataccgtcattgatgctgtgagcaaaatcagagatactgcc
acatcccacgaacgtacctttattgtcgaagttatgggcagggattgcgggaacatagca
cttcaggcagggatagcctgtggagcggaatctattctggttccggagattccttatgat
ttggaggaaatctgtgataagttgaaacgaggccatcagcgtgggaagaatcacagtatc
atcattgtttcagaaggtgtgggaaaagcctatgaaatcggcgaggaattacgttcccgt
accgggtttgaaacccggattaccatactgggacatttacagcggggtggaaaccccagt
gccttagatgctgtgatagctgcttctatgggaggaaaggccgtggaaatcattctggcc
aatgagaccaataagatgactgcttatgttaatcaagtggttgtttccagacccttggat
gttgcatacggagagcggcggccatttaatcaagacctttatgaattggctaatcagctc
tcaatttaa

DBGET integrated database retrieval system