KEGG   Desulfosporosinus orientis: Desor_3412Help
Entry
Desor_3412        CDS       T01675                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dor  Desulfosporosinus orientis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desor_3412
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desor_3412
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desor_3412
Enzymes [BR:dor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desor_3412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3531024..3532493)
Genome map
AA seq 489 aa AA seqDB search
MYESTRGNLNGQTASQAITLGMVPSGGLFVPSTFPNLNWQDLQGLTYRDVAKQVMMPYLA
DFPEEAVSSIVDVYRDGTFDGEDPAPLVSVGKFGVLELWHGPTAAFKDMALQVLPDLLKV
SLKQFNRDEDVLILVATSGDTGKAALEGFKNRKGMHIVVFYPDGGVSPVQERQMTTTEGS
NTHVVAVKGNFDQCQTAVKQIFASESLKRRLQEKNLIFSSANSINWGRLLPQIVYYYWAY
LQAVKQGKVAAGSAMNVVVPTGNFGNLQAAYYAKCMGLPLDKIICASNTNNVLTDFFATG
VYQSQRTFYQTISPSMDILVSSNFERFLYEMSGRDAEKVRSWYDASNQGMFSVDDATLKA
CRNTVYAGWANEEETLETIAKSYQAYNYVFDPHTAVAMKVYDDYVSATKDQTFTAIASTA
SPFKFSSNVIRGLDQRESCADEWEALNRLSMLTGWKIPAGLQGLEKKPEKRVHSAIPEEI
AQLVQIMFG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaagcaccaggggtaatcttaatgggcaaacagcatcacaagcgatcacttta
ggaatggtaccgagtgggggactttttgttccttcaacatttcccaacttgaattggcaa
gaccttcaaggcttaacatatcgcgatgtcgctaaacaagtgatgatgccctatttagcg
gattttcctgaggaagcggtttcaagtattgttgatgtctatcgagatggcacttttgat
ggtgaagatccggcaccattagtgtctgtgggcaagttcggagttttagagctttggcat
ggccccacggctgcttttaaagacatggctttacaggtattaccggacttattgaaagtt
agtcttaaacaattcaaccgggacgaagatgtattaatactggtagccacatctggggat
acgggaaaagcggccttagaagggtttaaaaaccggaagggtatgcatattgttgtcttc
tatcctgacggaggtgtaagccctgttcaggagcgtcaaatgacaactacggaaggatcc
aatactcatgttgtagcagttaaggggaactttgatcaatgtcaaacggcagtgaagcaa
atcttcgcatcagagagtttgaaacgccggcttcaggaaaaaaatctgattttttcatcg
gctaattccatcaactggggccgtcttttgcctcagatcgtttactattattgggcctat
ttgcaggcggttaaacagggaaaggttgcagcagggagtgcaatgaatgttgtggttcct
actggtaactttggaaacttacaggcggcttattatgccaagtgtatgggtcttccccta
gacaaaatcatttgtgcctcgaatactaacaatgttctgacggatttttttgctacggga
gtttatcaaagtcaaaggaccttctatcaaactatttctccttccatggatattttggtt
tcaagtaattttgagcgctttctttacgagatgagtggacgagatgctgaaaaagtccgt
tcctggtatgatgcgagcaatcaggggatgttttctgtcgatgacgctactttaaaagct
tgccggaatacagtttatgcaggatgggccaatgaagaggagactctcgaaacaatcgcc
aaaagttatcaagcatacaattatgtttttgatccccatactgctgtagcaatgaaagta
tacgatgattatgtttccgcaacgaaggatcaaacattcacggcaattgcttcaacagcc
agtccttttaaattttcttcaaatgttatcagaggacttgatcaacgagagagttgcgca
gatgaatgggaagcccttaatcgcctaagtatgttaacgggatggaaaattccggcgggc
ttacaaggcttagagaaaaagccggaaaagagagttcattcggctattccggaagaaatt
gctcagttggttcaaataatgttcgggtaa

DBGET integrated database retrieval system