KEGG   Desulfosporosinus orientis: Desor_3501Help
Entry
Desor_3501        CDS       T01675                                 

Definition
heterodisulfide reductase subunit B
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
dor  Desulfosporosinus orientis
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dor01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:dor00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3611301..3612245
Genome map
AA seq 314 aa AA seqDB search
MEEYQRLSLIDPQRVANLPTPDKLFLFLSCTGSIEYPGTERAVRLVGEKLGIEFIESVDQ
TCCTGYMLTCNAVNPQLALASTSRNLSIPQEMGLDVGVFCNGCYGYLRELAHLLHSNPAF
KEVGDKANVALGRVKYHGHTKIYHVQELWYRQLDKISSLVKRPLTGLKIAAHYGCHYLAN
KDVAIDDAQYPTFHEEIFKALGATPVVYKERRACCGYSVGRGFTHKEETVLPHITNKMLS
AAEAGVQLMTTTCPGCNTALDREQKTITSRGKHVSIPVIDLSQLIAFALGAPVEQLGFKA
NTTPVLPVLGRFVK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaagagtatcaaagattatcccttattgatccgcaaagagtagccaatttgcctaca
ccggataaactattcctatttcttagctgtacagggagtattgaatatccgggaaccgaa
agagccgtaaggcttgttggggaaaaattaggcattgaatttatagaatccgtcgaccaa
acctgctgcacggggtatatgctaacctgtaatgccgtgaacccacagttagctctggcc
tccacttcccgcaatttaagtattcctcaggaaatgggactggatgtaggtgtgttttgt
aatggttgctatggatacttaagagaattagcccaccttttgcattccaaccctgctttc
aaagaagttggagataaagcaaatgtggccttgggacgtgtaaaatatcacggtcacacc
aaaatttaccacgtccaggaattatggtatcggcagttagacaaaataagcagcttagtc
aagcggcctttaacaggtctaaaaatcgcagcccattacggctgccactatttggctaat
aaagacgtggccattgatgatgctcaatatcctacctttcatgaagaaatttttaaagct
cttggagcgacgcctgtagtttataaagaacggcgtgcctgctgcggctattccgtgggc
agaggatttactcacaaggaagagacggtattgccccatattaccaataagatgctgagt
gctgctgaggcaggagttcaattaatgactacaacttgtccgggttgtaatactgccctc
gaccgtgaacagaagactatcacctcgagaggcaaacacgtaagtattcctgttattgat
ttatctcagcttattgctttcgctttgggcgcaccagttgagcagttaggctttaaagct
aatactactccagttctacccgtgctgggacgctttgttaagtaa

DBGET integrated database retrieval system