KEGG   Desulfosporosinus orientis: Desor_4266Help
Entry
Desor_4266        CDS       T01675                                 

Definition
(GenBank) aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00220  Arginine biosynthesis
dor00250  Alanine, aspartate and glutamate metabolism
dor00290  Valine, leucine and isoleucine biosynthesis
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01130  Biosynthesis of antibiotics
dor01210  2-Oxocarboxylic acid metabolism
dor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desor_4266
   00290 Valine, leucine and isoleucine biosynthesis
    Desor_4266
   00220 Arginine biosynthesis
    Desor_4266
Enzymes [BR:dor01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Desor_4266
    2.6.1.66  valine---pyruvate transaminase
     Desor_4266
Amino acid related enzymes [BR:dor01007]
 Aminotransferase (transaminase)
  Class I
   Desor_4266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AET69699
UniProt: G7WIX4
Position
complement(4407366..4408583)
Genome map
AA seq 405 aa AA seqDB search
MRTFNMSKKLDYVCYDVRGPVLEEAERMRSQGLDILSLNIGNPAPFGFEAPGEIIHQMME
NLHNAEGYSDSKGVLSAREAIVNYCEFKKIPQVGVNDVYTGNGVSELILMAMQGLLDNGD
EILVPAPDYPLWTAAITLAGGKAVHYICDEQSEWYPDIRDITSKITSKTKGIVIINPNNP
TGALYSTELLEQIAELARQHSLIIFSDEIYDRLVMDGAQHTSIASLAPDLLVVTLNGLSK
SHKIAGFRCGWMCLSGDKSHARGYIDGLNILSSMRLCSNVQSQYVITTALSDLHKCDDTL
LPGGRIYEQREYIVNALNNIPGLQVFKPKAAFYVFPRIDIKRFNITDDEKFILDFLHEKH
ILMVHGRGFNWLLPDHFRIVYLPKIEELKMACDRLGDFLEGYRQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgtttaatatgtcaaagaagctggattatgtttgttatgatgtgcgggggcct
gtgcttgaggaagccgagcgcatgcgcagtcaaggcctggatattttgagtttaaatatc
ggcaacccggcccccttcggatttgaggctcccggagagatcattcaccagatgatggaa
aacctgcacaatgcggaaggatattcggactcaaagggggttctctcagcccgtgaagcc
atcgtgaattactgtgaattcaaaaaaataccccaggttggggtcaacgatgtctatacc
ggaaacggtgtcagcgagttaatcctgatggctatgcagggactgctggacaacggagat
gagattctcgttcccgcaccggactatccgctctggacggcggctattacactggcaggg
ggaaaggccgtccattacatctgtgatgagcagtccgaatggtatcctgatatccgggat
atcacaagcaaaataacctcaaaaacgaaagggattgtgattatcaatcccaacaatccc
accggggcattgtattcaacggaattattggaacaaattgctgaactcgcccggcagcac
agtctgattattttctctgacgagatatatgaccgtctggttatggatggcgctcagcac
acttctattgcctcactggcccccgatctgttggttgtgaccctgaacggactttccaaa
tcccataagatcgccggattccgctgcggctggatgtgcttaagcggagacaaatcccat
gcccgcggctatattgacgggttgaacattctttcatccatgcggttgtgttcaaatgta
caatcccagtatgtcatcacaacagccctttccgacctccataaatgcgacgacactctt
ttgcccggaggacggatctatgagcagagggaatatatcgtcaatgccttaaacaatatt
cccggtcttcaggtgtttaaacctaaagcggccttctatgtcttcccccggattgatatt
aaacggtttaatatcacggatgatgaaaaattcatcctggattttcttcatgaaaaacac
atccttatggttcatgggcgcgggttcaactggttattgcctgatcatttccgtatcgtc
tatttgcctaaaatcgaggaattaaaaatggcctgtgaccgtctgggcgattttctggag
gggtaccggcaggcctaa

DBGET integrated database retrieval system