KEGG   Desulfosporosinus orientis: Desor_4331Help
Entry
Desor_4331        CDS       T01675                                 

Definition
(GenBank) alkylhydroperoxidase AhpD family core domain protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00010  Glycolysis / Gluconeogenesis
dor00020  Citrate cycle (TCA cycle)
dor00620  Pyruvate metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01200  Carbon metabolism
Module
dor_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_4331
   00020 Citrate cycle (TCA cycle)
    Desor_4331
   00620 Pyruvate metabolism
    Desor_4331
Enzymes [BR:dor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Desor_4331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh CMD Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AET69759
UniProt: G7WJA0
Position
complement(4486106..4487698)
Genome map
AA seq 530 aa AA seqDB search
MAHIMLMPKLGLTMKKGKIVSWLKKEGEAVDLGEALLEVMTEKVNINVESPYKGVLYKII
GAPGTSYPISVPLAVLAEEGDDAAALEAALDEAKSVLQAALAGGNDGAEKKKEAKPVKPF
GVFAGTGKVSPRAAKLAAKEGIAVELINGSGPNGKIVEADVLNYILQVKGEAASELRPID
PQSMRGVIADRMLKSRREAAHVTIMKDVDMTSLQDVRDQLNTLGADKRVKFSFTDFLVKF
TGQALAEYPLVNSRSTAKEIELAKSVHVGVAVALEEGLVVPNVKNVPLLSLEQISAKIKD
LAARARNSELDPSEIEQGTFTITNLGAYGVEGFTPIINRPETAILGVGTIKQKPVMVDGR
LENRYFMTLSLSFDHRIIDGSLAAEFLGRLIEMLENPYPWFQLQPQSNDDLLIQTGGQET
PHDLLEAFSGGIAELKEEAPELAIGFENLMAPVFCEGELGIMEKELMAVAVAVYGKCEYC
IAAHVYNAMNAGASADQVLEAAGVAVAFGGGPAMAYTVTKVRECVKAFGG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcacatataatgcttatgcccaaattaggtttaaccatgaaaaaaggaaaaatcgtg
agttggttaaaaaaggaaggggaggcggtggatctaggagaagctctcttagaggtgatg
accgaaaaagttaatattaatgttgaatcaccttataaaggcgttctttataagattatc
ggtgctccgggcacgagttatccgatctcagttccccttgctgttttagcggaagaaggg
gatgatgccgctgctttggaagccgctctggatgaagcgaaaagtgttttgcaagcggca
ctggccggcgggaatgatggagcagagaagaagaaagaagcaaaaccggttaaacctttt
ggggtttttgccggtaccggcaaggtatctcctcgtgcggcaaaactcgccgctaaagaa
ggtattgcggttgaattaatcaatggcagcggtccaaacggcaagattgtcgaagcagat
gtgttaaattatatccttcaggttaagggagaggccgcttcggagctgaggcctatagat
cctcagagtatgcggggcgttatagcggatcgtatgcttaaaagccggagagaggctgcc
catgtcaccatcatgaaagatgtggatatgacctcgctgcaagatgtccgagatcaatta
aatactctgggcgcagacaaacgagtaaagttttcctttacagatttcctggttaagttt
acagggcaggctttagcagaatacccgcttgtaaactcgcgaagcaccgctaaagagatt
gaattagccaaatcagttcatgtaggggtagccgtcgccttggaagaggggctcgtggtt
cccaatgtgaaaaatgttccgcttctttctcttgaacaaatttcggcaaaaataaaagac
ttggcagcgcgggctcggaattctgaacttgacccgtcagagatagaacaagggacgttt
acaattactaatttgggggcttacggtgtggaggggttcacacccattatcaatcggccg
gaaaccgctattctcggagttggtactataaaacagaaaccagtaatggtcgatggacgc
ttagaaaatcgctatttcatgaccctcagcctttcttttgatcacaggattatcgacggt
tccctggctgcggagtttttaggccggctcatcgaaatgttggaaaatccctatccttgg
ttccagttgcagccccaaagtaatgacgatcttctcattcagaccggaggccaagaaacc
cctcacgatctcttggaggcgttttccggcgggatagccgaattgaaagaagaagcaccg
gaattggccattggctttgaaaacctcatggcaccggtcttttgcgagggcgaattgggg
attatggaaaaagaattaatggcggtggccgtcgctgtttatggcaaatgtgagtactgt
attgctgcccatgtttataatgccatgaatgccggagcctctgctgatcaagttttggag
gccgccggagtcgctgtggcttttggaggcggcccggctatggcttataccgtaacaaaa
gttcgcgaatgcgtcaaagcttttggcggttaa

DBGET integrated database retrieval system