KEGG   Desulfosporosinus orientis: Desor_4452Help
Entry
Desor_4452        CDS       T01675                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00010  Glycolysis / Gluconeogenesis
dor00620  Pyruvate metabolism
dor00640  Propanoate metabolism
dor00680  Methane metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_4452
   00620 Pyruvate metabolism
    Desor_4452
   00640 Propanoate metabolism
    Desor_4452
  Energy metabolism
   00680 Methane metabolism
    Desor_4452
Enzymes [BR:dor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desor_4452
Lipid biosynthesis proteins [BR:dor01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desor_4452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AET69866
UniProt: G7W709
Position
complement(4627724..4630033)
Genome map
AA seq 769 aa AA seqDB search
MKEKQHDGLIEEKRLFFPPSEFSLKAVIKNHDIHELGQNEIKFWEEQGKRLHWFKPWDKV
LEWNHPFAKWYVGGKLNAAYNCLDRHLEGARRNKAAFVFEGELGDRRVLTYQDLHREVSQ
FANVLKSYGVQKGDRVTIYMPMIPEAVIAMLACARIGAPHCVVFGGFSAEALRDRVQDAQ
AKVVVTSDGSFRRGKTIPLKDGVDQALQNVTCVKKVIVVQRTGQHVEMQEDRDVWYHEVI
KNASIICPAEPMDANDMLFILYTSGTTGKPKGVVHTVGGYMVGVSTTHEWVFDLKEEDVY
WCTADIGWITGHSYLVYGPLANGATVFMYEGAPDYPEKDRYWEIIENYRVSILYTAPTAI
RTFMKWGESYPSGRDLSSLRLLGSVGEPINPEAWMWYYKYIGGERCPIVDTWWQTETGMI
MMAPVPGITPLKPGSCTRPFPGICIDIIDHEGNIVPKGEGGYLVVRKPWPAMLKTVYGDD
KRYEDTYWNQFKGVYFTGDEAKWDEDSYFWVIGRVDDVINVSGHRIGTAEVESALVDHSL
VAEAACVGRTHEVKGQAVFAFVSLKEGVVIGDKLIDELKAHVVLKIGSIARPDDIFLTAE
LPKTRSGKIMRRLLKDIAEGRAMGDTSTLSDASVINFLQKNIHTQKIQAAQNASTTLGNR
ILIPDSAMFNRCKAESYEGYSYTVWFSTPPKDGSRHPVTNFYCFKWIERLNLAAEVALAM
SNIIINNSNAVEAIFGNGTPDFRYAVINEGNIKDDLSEEGQICFCGSAG
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaacaacatgacggtttgatagaggaaaaacggttgtttttccctccttct
gaatttagcttaaaagccgtcataaaaaatcatgatattcatgaactagggcaaaatgaa
attaagttctgggaagaacaggggaaacggttacattggtttaaaccatgggacaaagtt
ctggaatggaaccatccatttgcaaagtggtatgtaggcggaaagttaaatgcagcgtat
aattgcctggaccgacatttagagggggcacgtcggaataaagcggcctttgtatttgaa
ggagaactaggagatcgtagagtcttaacctatcaggatcttcatcgtgaggtatctcag
tttgcaaatgttcttaagtcttatggagtacaaaaaggagaccgagtgacaatctatatg
cctatgatcccagaggctgtgatcgcaatgcttgcttgcgctaggattggagctcctcat
tgtgttgtgttcggaggatttagtgcagaagctttaagggacagagttcaagatgcacag
gcaaaagtagttgtcacgtcggatgggagttttcgtcgcggaaaaaccatccctttaaaa
gatggtgtagaccaagcacttcaaaacgtaacttgtgttaaaaaagtgatcgttgttcaa
cgaacaggtcagcatgtagagatgcaagaagatagggatgtttggtatcacgaggtcata
aagaacgcctcaatcatctgtccggcagaaccaatggatgccaatgatatgctgtttatt
ctttataccagcgggacaaccggaaaaccaaaaggtgtggttcatactgttggcggttat
atggttggggtatcaacaactcatgaatgggtatttgaccttaaagaagaagatgtatat
tggtgcactgcggatattggatggattacaggacatagttatttggtctatgggccatta
gcaaatggtgcaacagtttttatgtatgaaggagctccggattacccagaaaaggatcgg
tactgggaaatcattgagaattacagggtgagtattttatacactgcaccaactgcgatt
cggacgtttatgaaatggggggagtcctatccttccggaagggatctttcaagcttaagg
ctcctgggttcagtcggtgaaccaatcaacccggaagcgtggatgtggtattacaaatat
attggcggagaacgttgtccaatagtagatacttggtggcaaacggaaacgggcatgatc
atgatggcacccgttcctggaataacacctctaaagcccggatcgtgtaccagaccgttc
ccaggaatctgtatcgacattattgatcatgaagggaatatcgtacctaaaggagaaggt
ggatatttagtagtccgcaagccttggccggcgatgcttaaaaccgtgtatggtgatgat
aaacgctatgaggatacgtattggaaccagtttaaaggtgtgtatttcactggagacgaa
gcaaaatgggatgaagatagttatttttgggtgattgggcgtgtagatgacgttattaat
gtctctggacatcggattggaacggcggaagtagaaagtgcgttggtcgatcattcattg
gttgctgaagcagcctgtgtgggtaggacccatgaagtaaagggtcaagcggtatttgct
tttgttagtttaaaagaaggggtcgtaatcggcgataagctaattgatgaactgaaagcc
catgtggtcttaaaaatcggttcaatagcacgaccggatgacatttttctaacggctgaa
ttacctaagacacgaagcggaaaaataatgagacgtcttcttaaagacatagcagagggc
agggcaatgggggatacgagcactctttctgatgcttcggtcataaatttcttgcagaag
aatattcacacccaaaaaattcaagctgcgcaaaatgcctcaacaacattaggaaatagg
attttaattcccgactctgctatgtttaatcgttgcaaggcggagtcttatgaagggtat
agttacacggtatggttttcaacacctccaaaagatggatcacgtcatccggtaactaat
ttttattgctttaagtggatagaaagattaaacttggcggccgaagttgccttagctatg
tcaaatatcattataaacaatagtaatgctgttgaagcaatatttggaaatggaacaccg
gattttcgctatgcggtaatcaatgaaggcaatattaaagatgacttatcagaggaaggg
cagatatgtttttgtggttcggcgggctag

DBGET integrated database retrieval system