KEGG   Desulfosporosinus orientis: Desor_4589Help
Entry
Desor_4589        CDS       T01675                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00010  Glycolysis / Gluconeogenesis
dor00020  Citrate cycle (TCA cycle)
dor00620  Pyruvate metabolism
dor00633  Nitrotoluene degradation
dor00640  Propanoate metabolism
dor00650  Butanoate metabolism
dor00680  Methane metabolism
dor01100  Metabolic pathways
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01200  Carbon metabolism
Module
dor_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_4589
   00020 Citrate cycle (TCA cycle)
    Desor_4589
   00620 Pyruvate metabolism
    Desor_4589
   00640 Propanoate metabolism
    Desor_4589
   00650 Butanoate metabolism
    Desor_4589
  Energy metabolism
   00680 Methane metabolism
    Desor_4589
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desor_4589
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desor_4589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AET69994
UniProt: G7WC20
Position
complement(4785477..4785914)
Genome map
AA seq 145 aa AA seqDB search
MREIRFHGRFGQPVGKLTRAMGKELLHQGKHVQVFDAFAAVRPGAPMYSVIRVGDESIRK
RSANNTMPDIVVVLDNSLFGVIDVTKGLKSDGTVMALGVTENALGEKLKGFSFVSLDPYL
QPNSSDLAAVFLKVLAERGVLMVNK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaaattcgctttcatggccgctttggccagccggtagggaagctaactcgggca
atggggaaagaacttttgcatcaaggcaagcatgtccaagtttttgatgcgtttgccgct
gtgcgtcccggggctcccatgtactccgttattcgagtgggagatgagtcgattcgaaaa
cggtccgcgaataatacgatgcctgatatagttgtggttttagataatagtttatttggt
gttatagacgtgaccaaaggtcttaagtcagatggaacggtgatggcgttgggtgtaact
gagaatgctctcggggagaaattaaaaggtttttcctttgtttctcttgacccttacctt
caacctaatagctctgatttagcggcagttttccttaaagtcttggccgaacgcggtgtt
ttgatggtcaacaagtaa

DBGET integrated database retrieval system