KEGG   Desulfosporosinus orientis: Desor_4590Help
Entry
Desor_4590        CDS       T01675                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
dor  Desulfosporosinus orientis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desor_4590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_4590
   00020 Citrate cycle (TCA cycle)
    Desor_4590
   00620 Pyruvate metabolism
    Desor_4590
   00640 Propanoate metabolism
    Desor_4590
   00650 Butanoate metabolism
    Desor_4590
  Energy metabolism
   00680 Methane metabolism
    Desor_4590
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desor_4590
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desor_4590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4785914..4786783)
Genome map
AA seq 289 aa AA seqDB search
MALSIADLSKEDLFGQGHAGCGGCGAAVAGRQAMKALGSRTIITIPASCMATLGGSNLKT
TWQIPFYHTLFEMAPAISSGIRAALEAQGIEDVNVVSWAGDAGTADIGFQSLTGAAERNE
HMIHVCYDNEMYMNTGGQTGSQTPMYAITSNMTKGKMVKKKNMLAIMEAHGIDYVASASI
AYPLDLIAKFRKAAEKPGFSYIHILAPCHRGWQIPPEKTIEFARLAVDSGLFELYEVDNG
LRTRTFEPPLIPVEDYLINQGRFRHLTSEQVAGIQKSVNAYYSRGGSEK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcactatccattgcagatttgtcgaaagaggatctatttggtcaaggacatgcgggt
tgtggggggtgtggcgcagctgtcgctggcaggcaagcaatgaaggctcttggctctaga
acgattattacaattccagcctcatgcatggcaaccttagggggctcaaacctgaagacg
acttggcaaattcccttttatcatacgctatttgaaatggctccggcgatatcttccgga
attagggcggctctagaagcgcagggaatagaagatgttaacgtagtttcttgggcaggg
gatgcgggaacagcagatattgggtttcaatccttaaccggtgcagctgaacgcaatgaa
cacatgattcacgtgtgttatgacaatgagatgtacatgaatacgggcggacaaacgggc
agtcagacccccatgtatgcgattactagtaatatgacgaaggggaaaatggtcaaaaag
aagaatatgttggccatcatggaagcgcatggcatagattatgtagcgagtgcctccatt
gcttatccattagatctgattgcgaagtttagaaaagcagcagaaaaacccggtttttcc
tatattcatatcctagcaccttgtcataggggctggcaaattccgccggagaaaactatt
gagtttgcacgattagctgttgatagtggtctttttgaactttatgaagtggataatgga
ttgcgtactcgaacttttgagccccctttgattcctgttgaagattatctgatcaaccaa
gggcggtttagacatctcacctctgaacaggtcgcagggatccagaaaagtgttaatgcc
tactatagcagaggggggagtgaaaagtga

DBGET integrated database retrieval system