KEGG   Desulfosporosinus orientis: Desor_4640Help
Entry
Desor_4640        CDS       T01675                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00900  Terpenoid backbone biosynthesis
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desor_4640
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Desor_4640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: AET70044
UniProt: G7WE68
Position
complement(4834272..4835426)
Genome map
AA seq 384 aa AA seqDB search
MNSLKTLTLLGSTGSIGRQTLDVVRHAEGCLKIHALGAGKNVRLMEEQARLFRPAVAVMM
DETAARELRERLKDLPIKVDQGMEGIINSVTAEEVDTVVTALSGRVGLEPTLEAIKAGKT
IALANKETLVAGGDLVMSSAQAMNCKILPVDSEHSAIFQCLEENPETIERIILTASGGPF
FGWSKERLESVTLENALRHPNWEMGAKITIDSSTMMNKGLEVIEAHHLFNVAYDGIEVLI
HPQSVVHSMVEYYDGSVLAQLGRPDMRLPIQYALSYPTRWKNPFERLDLRGKTLTFHEPD
FEAFPALALAYQAGRRGGTLPAAMNAANEVAVSAFLQRKVSYLGIIDIVGEVCAEHKVLD
SMDLDSILDADSWARHRAEELILT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcttgaaaactctcactctattaggatcaacagggtccattggacgtcaaaca
ctggatgttgtacgtcacgctgaaggctgccttaaaatccatgccttgggggcagggaaa
aatgttcggctaatggaagaacaggcgcgtttgtttcgcccggcggtcgctgtgatgatg
gacgagactgctgcccgtgagctacgggagcggttgaaggatctgcccattaaggtagac
caaggtatggaaggtattattaattctgtaactgctgaagaggtggatacggttgttact
gccttgtcaggcagagtaggacttgagcccactcttgaggccattaaagccggaaaaact
atcgcattggctaataaagaaaccttggtggccggcggagatttagtcatgtcttcggcc
caagccatgaattgcaaaatactccccgttgacagtgaacactcggccatttttcagtgt
ttggaagagaacccggaaacaattgagcgtattattttaacagcatccgggggtcctttt
ttcggctggagtaaggaaaggttagaaagtgttaccctagaaaatgctctccgtcatcct
aattgggagatgggcgcgaaaattactattgattcttcgacgatgatgaataaaggtctt
gaagtcattgaagcgcatcatttatttaatgtggcgtatgatgggatagaggttcttatt
catccccaaagtgtcgtacactctatggtggaatattatgatggctcagtcttggctcag
ttaggcagaccggatatgcgcttgcccattcaatatgccttaagttacccgacacgctgg
aagaatccttttgagcgtctggacctcagaggaaaaaccttaacctttcatgaacctgat
tttgaggcttttccagccctagccttagcctatcaagctggaagacgaggaggaaccctg
ccggcggcgatgaatgctgccaatgaagtagcagtctcagcatttctgcaaagaaaagtt
tcttatttgggcataatagatattgttggagaagtatgtgctgaacataaggttttagac
agcatggatttggacagcatactcgatgcagacagttgggcacgtcaccgggccgaagag
cttatattaacttaa

DBGET integrated database retrieval system