KEGG   Desulfosporosinus orientis: Desor_4748Help
Entry
Desor_4748        CDS       T01675                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dor  Desulfosporosinus orientis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Desor_4748
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Desor_4748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4941455..4942063)
Genome map
AA seq 202 aa AA seqDB search
MEKSHGLLIVLSGPSGAGKGTLCQELLRQMPDLKYSVSMTTRSSRPGEVDGIHYFFRQKA
EFEAMINRDELLEWAKFCDNYYGTPRFAVEQAIQAGQDVILEIEIQGALQIKKCFPQGVF
TFIVPPSMDVLSERIHKRGTETEEVIQKRLATAIEELEYVSEYDYVVVNDEVPVAVDKLK
SILIAEKCRVKRKPFVFKGESV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaagtcatggattattgatagtgctgtcgggcccttccggagcaggcaaaggg
acgctttgccaagaattgctgcgccagatgcctgacttaaaatattccgtctcgatgaca
acaagatcttctcgtcctggtgaagtggatggaattcattacttttttcgacaaaaggct
gaatttgaagccatgattaacagagatgaactgctggaatgggcaaagttctgtgataat
tactatggaacaccgcgcttcgcagttgaacaggctatccaagcaggacaggatgtcatt
ttagagatagaaattcaaggtgctttacaaattaaaaagtgctttcctcaaggagttttc
acttttattgtcccgccttcaatggatgtactctctgagagaattcacaagcggggtacg
gaaacggaggaagtgattcagaaaaggttagccactgccatagaggagctggaatatgtc
agtgaatacgattatgtcgtggtcaatgatgaggttcccgtggctgtcgataaattaaaa
agtattctcattgcagaaaaatgccgtgttaaacgaaaaccgtttgtttttaagggggaa
tctgtatga

DBGET integrated database retrieval system