KEGG   Desulfosporosinus orientis: Desor_5344Help
Entry
Desor_5344        CDS       T01675                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dor  Desulfosporosinus orientis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desor_5344
   00052 Galactose metabolism
    Desor_5344
   00500 Starch and sucrose metabolism
    Desor_5344
   00520 Amino sugar and nucleotide sugar metabolism
    Desor_5344
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desor_5344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5569236..5570126)
Genome map
AA seq 296 aa AA seqDB search
MRRIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDIIIVTGRN
KRAIEDHFDRSMELESFLEKNSKDELLDLVQDIAQLADIYYVRQKEALGLGHAIYSARKF
IGNEPFAVLLGDDVIYSKVPALRQMINHYQRYGASMVGVQEVPLEDTIKYGIVDGEKFAD
RLYRAKNMVEKPRSEDAPETRLAIMGRYILNPEIFGILEDLPEGRGGEIQLTDGIKELGR
YQEILAYEFEGRRYDVGDKLGFVEATIDYALRRDDLSAELIDYLRDIVRCADENRG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagaattcgtaaagcagtgataccagcggctggactgggaactcgtttcttgccg
gcaacaaaggctcaaccgaaagaaatgctgcctatagtggataagcccactattcaatac
attgttgaagaggctattcaatctggcatagaagatattattattgttactggccgtaat
aaacgggccattgaagaccatttcgaccggtccatggagcttgaaagctttctggagaaa
aattccaaagatgaacttttggatttagttcaggatattgcccaactggctgatatatat
tatgtgcgtcaaaaagaagccttaggattagggcacgcaatttatagtgctcgaaaattt
attgggaatgagccttttgcagtcctattgggggacgatgttatttattcgaaagtgccc
gctttacgacaaatgataaaccactaccagcgctatggcgccagtatggtgggagttcag
gaggttcctttggaggatacgattaaatatggaattgtcgatggggaaaagtttgcggat
agactctatcgtgccaaaaatatggtggaaaaacctcgttcagaggatgcccctgaaact
cgcttggcgatcatgggccgatacatcttgaatccggaaatttttggcatactggaagat
ttgccggaaggcagaggcggggagatacagcttacggatggaattaaggaactgggacgg
tatcaagaaattttggcttatgaatttgagggccgccgatatgatgttggggataagctt
ggctttgtagaggcaaccattgactatgcattgcggagagacgatctttcagcagaactc
attgattacttgcgggatattgttcgatgtgcagacgagaatagaggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system