KEGG   Desulfosporosinus orientis: Desor_5455Help
Entry
Desor_5455        CDS       T01675                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dor  Desulfosporosinus orientis
Brite
Enzymes [BR:dor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Desor_5455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5682563..5683324)
Genome map
AA seq 253 aa AA seqDB search
MDPQQHLVEPFYFPGNRLGCLLIHGFSGSSSEMRWMGERLAEFGWSVLGIQLSGHGTTPE
EMAKTCWADWARDAENGLNELRKTCDTVIGIGLSMGGLLVLHLATLGLIHGLVAMNAPMV
LADRRTRFVGLIKPFIKFVNKPGSRSKTSSLGLDPDRERFVYDRIPVEALVSLNRGIRQV
RSKLHLISCPSLIMQSRKDYTVNPISMEIIKEKIKQVNPLTYYWEKSGHILTLGQEREEV
IKKIHEFLDNHIL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggacccgcaacaacatttagtggaacctttttattttcctggaaaccgtctgggctgc
ttgctgattcatggcttttctggatcgtcttccgaaatgcgctggatgggtgagcgatta
gcggagtttggttggtctgtcctgggaatacaactttccggtcatggaaccactcccgaa
gagatggccaagacttgttgggcagactgggccagggatgcggaaaacgggttaaacgag
ttaagaaaaacttgcgataccgtgattggaatagggttgtctatgggaggattactggtg
ctccatctggcaacacttggtcttatccatgggctggtggcaatgaacgctcccatggta
ctggcagataggagaacccgtttcgttgggcttatcaaaccttttatcaagtttgtcaac
aagcccggctcccggtcgaaaacatcatccctgggattagatcccgatagggagcgcttt
gtttatgatcgtattccggtggaggccttggtatcgctgaatagaggaattcgccaggtg
cgcagcaaacttcatctaattagctgcccgtcattaataatgcaaagcaggaaagattat
acggtgaaccccatcagtatggaaattattaaagagaaaataaagcaggttaacccgctg
acatattattgggaaaaatccggacatattttaaccctcggacaggaacgagaggaagtt
attaaaaaaatacatgaatttctggacaaccatattctttag

DBGET integrated database retrieval system