KEGG   Desulfosporosinus orientis: Desor_5459Help
Entry
Desor_5459        CDS       T01675                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dor  Desulfosporosinus orientis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desor_5459
   01230 Biosynthesis of amino acids
    Desor_5459
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_5459
   00051 Fructose and mannose metabolism
    Desor_5459
   00562 Inositol phosphate metabolism
    Desor_5459
Enzymes [BR:dor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desor_5459
Exosome [BR:dor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desor_5459
  Exosomal proteins of bladder cancer cells
   Desor_5459
  Exosomal proteins of melanoma cells
   Desor_5459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5686698..5687471)
Genome map
AA seq 257 aa AA seqDB search
MAKRRPVIAGNWKMFKTVSQAEDYALKFLDEVRNVTELDIVLCAPFTALYALKNELEESI
VHLGAQNMAWADQGAYTGEISAEMLLDVACTYVILGHSERREMFGETDPDIAKKVKKALA
AGLTPILCCGENLNLREEGKAVQWVQGQVSRALAGISAEKLERIIVAYEPIWAIGTGKTA
SSKDAQEMCAAIRVTLTELMGQDVEKVPILYGGSVKPDNIAELMAEPDIDGALVGGASLD
PLNFADLIKNAGNLASR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaacgacgcccagttatagcaggaaactggaagatgtttaaaactgtcagccag
gcggaggactatgcccttaagttcttggatgaagttcgcaatgtgacggaactggatatt
gtgctctgcgctccctttacagctctgtatgcccttaaaaatgagctggaagaaagtatt
gttcacttgggcgcccaaaacatggcctgggccgatcaaggtgcctataccggtgagatt
tcggcggaaatgttgcttgatgttgcctgtacttacgtcatattaggtcattcagaacga
cgggagatgttcggagaaacggatcctgacattgctaaaaaagtaaaaaaagcgctggca
gcggggttaactcccatcctttgttgtggagagaatctgaaccttcgtgaagaaggaaaa
gctgttcagtgggtccaaggtcaagtgtcacgtgcattggccggcatatcggctgaaaag
ctagagcgaatcattgttgcttacgaacccatctgggccataggcaccggcaagacagct
tccagcaaggatgcccaggaaatgtgcgctgccattcgtgtcactctgacagaacttatg
ggacaggatgttgagaaggtgcctattctctatggcggaagtgtcaaaccggataatatt
gctgagttaatggcagaaccggatattgacggagcattagtgggtggggcaagtcttgat
ccgctgaactttgccgatcttatcaaaaatgcagggaatctcgcatcccgctag

DBGET integrated database retrieval system