KEGG   Desulfosporosinus orientis: Desor_5461Help
Entry
Desor_5461        CDS       T01675                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dor  Desulfosporosinus orientis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Desor_5461
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Desor_5461
Exosome [BR:dor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desor_5461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5688955..5690451)
Genome map
AA seq 498 aa AA seqDB search
MSNQYILALDQGTTSCRAILFNHSSDVIGVAQKEFRQFYPKPGWVEHDAEEIWSTQYGVI
AELLAKTSISPEDIAGIGITNQRETTVVWDKFTGKPIHPAIVWQCRRTTEIVEDLKAKGW
DKSIRQKTGLVLDAYFSGTKVKWILDHCQGAREKAARGELLFGTIDTWLIWKLTGGKVHV
TDYSNASRTMLYDIHQLKWSEEILAELDIPMNMLPEVKPSSCVYGYTEIPLFGKCSVPIS
GTAGDQQAALFGQMCFEPGMAKNTYGTGCFMLMNTGERAVPSQSGLLTTIAWGMEGNINY
ALEGSVFIAGAAVQWLRDGLKIIQSAGDSEQAAAAVEDTNGVYVVPAFTGLGAPYWDMRA
RGAIFGLTRGTTQAHLIRATLESMAYQTKDVLGAMEKDAGITLQTLRVDGGAVANNFLMQ
FQSDILGVGVERPEVIETTALGAAYLAGLAVGYWKNKEEICSSWKLNRSFTPKMSEEYRS
KLYRGWLKAVERSKDWED
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaatcaatacattttagccttagatcaagggacgacgagctgccgggcgatattg
ttcaatcactctagtgatgttattggggttgcccaaaaggagttcaggcaattttatcct
aagcccggctgggtagaacatgacgcagaagaaatctggagtacccagtatggtgtcatt
gccgaattgctggctaaaaccagtatatctccggaggacatagctgggataggcattacc
aatcaacgagagaccactgttgtctgggataagtttaccgggaagccaatccatcctgcc
atagtctggcaatgccggcgtactacggagatcgtggaagatctaaaagcaaagggttgg
gataaaagcatccggcaaaaaacagggttggtcttagatgcttacttttcaggtaccaaa
gtgaaatggattctggatcattgccagggcgcccgtgaaaaagcggcccggggggaattg
ttgttcggaaccattgatacttggctgatttggaaattgaccggcggcaaagttcatgtg
acggattactcaaatgcttcgcgaacgatgttgtacgatattcaccaattgaaatggtcc
gaggaaattctggccgaactggatatccccatgaacatgctgccggaggttaagccctca
agttgcgtctatggatatacggagatacctctctttggcaagtgttccgttccaatttca
gggactgccggggatcagcaggcggctttgttcggacagatgtgttttgaaccgggtatg
gccaaaaatacttatggaacaggctgttttatgctgatgaacacgggagaaagagcggta
ccctcccaaagcgggttgttaacaaccattgcctggggaatggagggtaacataaattat
gccttagaaggcagtgtgtttatagcaggggcggcggtccaatggctgagagatgggctg
aaaattattcagtcggccggggattctgagcaggctgctgcggcggtggaggataccaat
ggagtgtatgtggttccggccttcacgggtttgggagccccttactgggatatgcgcgct
cgaggtgctatctttggcctgaccagaggaacaactcaggctcatttgatccgagccaca
ttggagtccatggcttatcaaacgaaagatgttttgggcgctatggaaaaggatgcgggg
ataactttacagacgttaagagtcgacggtggggctgtagccaataattttttaatgcag
tttcagtccgatatcttaggtgtgggcgtggaacgaccggaagtgattgagacaacggca
ctgggagctgcttacttagcaggcttagccgttggctattggaagaataaagaggagatc
tgctcaagctggaaattaaatcgttcctttacaccgaaaatgtctgaggagtacagaagc
aaactttatcgtggctggctgaaagccgtcgaacgaagcaaagattgggaggactaa

DBGET integrated database retrieval system