KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0106900-01Help
Entry
Os01t0106900-01   CDS       T02163                                 

Gene name
Os01g0106900
Definition
Similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Fragment).
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Os01t0106900-01 (Os01g0106900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Os01t0106900-01 (Os01g0106900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(380398..380488,379206..379387,378841..378927,378616..378741,378471..378533,377617..377766,377314..377381,377123..377234,376938..377042,376647..376768,376003..376149,374980..375148))
AA seq 473 aa AA seqDB search
MALKVVSFPGDLAAVSFLDSNRGGAFNQLKVDLPFQTRDRRAVSLRRTCCSMQQAPPPAW
PGRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQ
VKTFKPKLVAVRNESLVDELKEALADCDWKPEIIPGEQGVIEVARHPDAVTVVTGIVGCA
GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQCIQGLPE
GALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEA
HYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRIYCSEV
TWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVELFIDEKIG
YLDIFKVVELTCDAHRNELVTRPSLEEIIHYDLWAREYAASLQPSTGLSPVPV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaaggtcgtctctttccccggggacttggccgcggtctcattcctcgactcc
aacagaggaggagctttcaaccagctcaaagtggacctcccgtttcaaacgagggacaga
agagcagtttccctgagaaggacttgctgttcaatgcaacaggctccaccaccagcatgg
cctggtcgagccgttgttgaacctgggaggaggtcatgggatggccccaagcctatctca
attgttggctcaaccggttctattggcacacagacattggacatagttgcggagaatcca
gataaattccgggttgttgctcttgctgctggctccaatgtgactcttctagctgatcag
gtgaaaacattcaaaccaaagcttgttgctgtaagaaatgagtcattagttgatgagcta
aaggaagccttagctgattgtgattggaagccagaaattattcctggtgagcaaggtgtc
atagaggttgctcgccacccagatgcagttacagttgttactgggatagtagggtgtgca
ggactgaagcctacagttgctgcaattgaagctgggaaagatatagcattggcgaacaaa
gagacacttattgcaggtggtccttttgtgcttccccttgcacaaaagcacaaagtgaaa
atacttcctgctgattctgagcactctgctatatttcagtgtatacaaggcttgcccgaa
ggagcacttcgccgcattattttgactgcatcaggtggtgctttcagggactggccagtt
gacaagttgaaagaagtaaaagttgctgatgctttaaagcacccgaactggaatatgggg
aagaagattactgtagattctgctacattattcaacaagggtttagaagttattgaagca
cattatttatttggtgctgaatacgatgacattgaaattgtgatccacccacaatctatc
atacactctatgattgaaacccaggattcatctgtgttggctcaactgggatggccagat
atgcggataccaatcttatacaccatgtcttggccagacagaatctattgctcagaggtc
acctggccccgactagatctttgcaagctgggttcactgacattcaaagctcctgacaat
gtgaaatacccgtcgatggatctcgcctatgcagctggaagagctgggggcaccatgaca
ggagttctgagtgctgctaatgagaaggctgtggagttgttcatcgatgaaaagatcggg
tacctggacatcttcaaggtggtggagctgacatgcgacgctcatcggaatgagctagta
acaaggccatcactggaggagatcatacattatgatctgtgggcgagggagtatgctgcc
agcctacagccatccactggcctcagccctgtacctgtctag

DBGET integrated database retrieval system