KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0147900-01Help
Entry
Os01t0147900-01   CDS       T02163                                 

Gene name
Os01g0147900, TPI, TRIOSEPHOSPHATE_ISOMERASE
Definition
(RAP-DB) Triosephosphate isomerase, cytosolic (EC 5.3.1.1) (TIM) (Triose- phosphate isomerase).
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os01t0147900-01 (Os01g0147900)
   01230 Biosynthesis of amino acids
    Os01t0147900-01 (Os01g0147900)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os01t0147900-01 (Os01g0147900)
   00051 Fructose and mannose metabolism
    Os01t0147900-01 (Os01g0147900)
   00562 Inositol phosphate metabolism
    Os01t0147900-01 (Os01g0147900)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os01t0147900-01 (Os01g0147900)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Os01t0147900-01 (Os01g0147900)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Os01t0147900-01 (Os01g0147900)
  Exosomal proteins of bladder cancer cells
   Os01t0147900-01 (Os01g0147900)
  Exosomal proteins of melanoma cells
   Os01t0147900-01 (Os01g0147900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:complement(join(2593479..2593517,2592297..2592372,2592040..2592163,2591601..2591685,2591198..2591330,2590622..2590716,2590414..2590492,2590214..2590296,2590074..2590121))
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEI
QVAAQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRSLLGESNEFVGDKVAYALSQ
GLKVIACVGETLEQRESGSTMDVVAAQTKAISERIKDWTNVVVAYEPVWAIGTGKVATPD
QAQEVHDGLRKWLAANVSAEVAESTRIIYGGSVTGANCKELAAKPDVDGFLVGGASLKPE
FIDIINSATVKSA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgttggtggcaactggaaatgcaacgggaccactgatcaggtg
gacaaaattgtgaaaattctgaatgagggacagattgcttctacagatgttgttgaggtg
gttgtcagcccaccttatgtgttccttcccgtggtcaagagtcagctgcgcccggagatc
caagttgctgctcagaattgttgggtgaagaagggcggggctttcaccggtgaggtcagc
gctgagatgcttgtcaaccttagtattccctgggttattcttggacactctgaaaggagg
agtttgttgggtgaatcaaatgagtttgttggagacaaagtggcatatgcgctctctcag
ggcttgaaggtcattgcatgtgttggtgagactctcgagcagcgggaatctggttcgacc
atggatgttgttgctgcacaaacaaaagcaatttctgaaaggatcaaggattggactaat
gtggttgttgcctatgaacctgtgtgggccattggaactggtaaagttgctacaccagat
caagcacaagaagtgcatgatggcctgaggaagtggctcgctgctaatgtcagtgcagag
gttgctgaatcaacaaggatcatctatggaggttccgtaactggtgcgaactgcaaggag
ctggcagcaaagcctgatgttgatggttttctcgtcggtggtgcttcattgaagcctgaa
ttcatcgacatcatcaactccgccaccgtgaagtccgcctaa

DBGET integrated database retrieval system