KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0147900-01Help
Entry
Os01t0147900-01   CDS       T02163                                 

Gene name
Os01g0147900, TPI, TRIOSEPHOSPHATE_ISOMERASE
Definition
Triosephosphate isomerase, cytosolic (EC 5.3.1.1) (TIM) (Triose- phosphate isomerase).
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os01t0147900-01 (Os01g0147900)
   01230 Biosynthesis of amino acids
    Os01t0147900-01 (Os01g0147900)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os01t0147900-01 (Os01g0147900)
   00051 Fructose and mannose metabolism
    Os01t0147900-01 (Os01g0147900)
   00562 Inositol phosphate metabolism
    Os01t0147900-01 (Os01g0147900)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os01t0147900-01 (Os01g0147900)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Os01t0147900-01 (Os01g0147900)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Os01t0147900-01 (Os01g0147900)
  Exosomal proteins of bladder cancer cells
   Os01t0147900-01 (Os01g0147900)
  Exosomal proteins of melanoma cells
   Os01t0147900-01 (Os01g0147900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:complement(join(2593479..2593517,2592297..2592372,2592040..2592163,2591601..2591685,2591198..2591330,2590622..2590716,2590414..2590492,2590214..2590296,2590074..2590121))
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEI
QVAAQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRSLLGESNEFVGDKVAYALSQ
GLKVIACVGETLEQRESGSTMDVVAAQTKAISERIKDWTNVVVAYEPVWAIGTGKVATPD
QAQEVHDGLRKWLAANVSAEVAESTRIIYGGSVTGANCKELAAKPDVDGFLVGGASLKPE
FIDIINSATVKSA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgttggtggcaactggaaatgcaacgggaccactgatcaggtg
gacaaaattgtgaaaattctgaatgagggacagattgcttctacagatgttgttgaggtg
gttgtcagcccaccttatgtgttccttcccgtggtcaagagtcagctgcgcccggagatc
caagttgctgctcagaattgttgggtgaagaagggcggggctttcaccggtgaggtcagc
gctgagatgcttgtcaaccttagtattccctgggttattcttggacactctgaaaggagg
agtttgttgggtgaatcaaatgagtttgttggagacaaagtggcatatgcgctctctcag
ggcttgaaggtcattgcatgtgttggtgagactctcgagcagcgggaatctggttcgacc
atggatgttgttgctgcacaaacaaaagcaatttctgaaaggatcaaggattggactaat
gtggttgttgcctatgaacctgtgtgggccattggaactggtaaagttgctacaccagat
caagcacaagaagtgcatgatggcctgaggaagtggctcgctgctaatgtcagtgcagag
gttgctgaatcaacaaggatcatctatggaggttccgtaactggtgcgaactgcaaggag
ctggcagcaaagcctgatgttgatggttttctcgtcggtggtgcttcattgaagcctgaa
ttcatcgacatcatcaactccgccaccgtgaagtccgcctaa

DBGET integrated database retrieval system