KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0152300-00Help
Entry
Os01t0152300-00   CDS       T02163                                 

Gene name
Os01g0152300
Definition
Similar to Histone H2B.1.
Orthology
K11252  
histone H2B
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os01t0152300-00 (Os01g0152300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(2820235..2820696)
AA seq 153 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAEKALAGKKPKAEKRLPAGKAEKSSGEGKKAGRKKAK
KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGESAKLARYNKKPTITS
REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggcggcgaagaagcccgcggaggaggagcccgcg
gcggagaaggccgagaaggccctggcggggaagaagcccaaggcggagaagcgtctcccc
gccggcaaggccgagaagagcagcggcgaggggaagaaggcggggcggaagaaggcgaag
aagagcgtcgagacctacaagatctacatcttcaaggtgctcaagcaggtccaccccgac
atcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgag
aagctcgccggggagtccgccaagctcgcgcgctacaacaagaagcccaccatcacctca
cgggagatccagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgccgtc
tccgagggcaccaaggctgtgaccaagttcacctccgcttag

DBGET integrated database retrieval system