KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0152700-01Help
Entry
Os01t0152700-01   CDS       T02163                                 

Gene name
Os01g0152700
Definition
Similar to Histone H2B (CaH2B).
Orthology
K11252  
histone H2B
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os01t0152700-01 (Os01g0152700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:complement(2838046..2838171)
AA seq 41 aa AA seqDB search
NKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
aacaagaagcccaccatcacctcccgggagatccagaccgccgtccgcctcgtcctcccc
ggcgagctcgccaagcacgccgtctccgagggcaccaaggccgttaccaagttcacttcc
tcctag

DBGET integrated database retrieval system