KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0174300-01Help
Entry
Os01t0174300-01   CDS       T02163                                 

Gene name
Os01g0174300
Definition
Flavoprotein pyridine nucleotide cytochrome reductase domain containing protein.
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Os01t0174300-01 (Os01g0174300)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Os01t0174300-01 (Os01g0174300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(3824230..3824349,3824108..3824150,3823367..3823442,3822889..3822948,3822372..3822422,3822216..3822270,3822021..3822091,3821885..3821936,3821666..3821743,3821330..3821419,3821127..3821240,3820867..3820935,3820479..3820535))
AA seq 311 aa AA seqDB search
MAALLLRRLAGTHRGRVPLAAAAAVTGGAALFCASSPPTIALMEEKGEDAAAKVALNPDK
WLEFKLQEKATVSHNSQLFRFSFDPSTKLGLDVASCLITRAPIGEEVEGGRKFVIRPYTP
ISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDVVEVKGPIEKLRYSPNMKKQIGMIAGG
TGITPMLQVVRAILKNPDDNTQVSLIYANVSPDDILLKRELDRLASSYPNFKVFYTVDKP
SNDWRGGVGYISKDIALKGLPRPGEDSLILVCGPPGMMNHISGDKAKDRSQGELTGILKE
LGYTAEMVYKF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgctgcttcgtaggctcgccgggacccaccgcggccgcgtgcctctggcc
gccgccgccgccgtcaccggtggagcggcgctcttctgcgcctcgtctcccccaaccatc
gcgctcatggaggagaagggcgaggatgccgctgctaaagttgcgcttaacccagacaag
tggctagagttcaagctccaggagaaggcaacagttagccacaattcacaattatttaga
ttttcgtttgacccatctactaagttgggtcttgatgttgcttcatgtctcataacaagg
gctccaataggagaggaagtggagggaggaagaaaatttgtcattcgcccgtacacacct
atctctgatccagattctaaaggatattttgacctgctaatcaaggtttatcctgatggg
aaaatgagtcagtatttcgcaagtctgaaaccaggagatgttgttgaggtcaaagggccc
attgaaaagctcagatatagcccaaatatgaagaaacaaattggcatgatcgctggtggg
actggcataacaccaatgctgcaggttgtcagggctatcctaaaaaaccctgatgacaac
actcaggtttccttaatttatgccaatgtgtcaccagatgatatcttgctgaaaagggaa
ttagatagacttgccagtagctatcctaatttcaaggtattctacacggtggacaaacca
tcaaatgattggaggggtggtgttggctacatatccaaggacattgccttgaaaggtttg
ccacggccaggggaggattctctgatccttgtttgtggtcctccaggtatgatgaatcat
atatccggtgacaaggcaaaggatagatcgcagggcgagctcaccggcattctgaaagag
ttaggatacactgcagagatggtatacaagttctga

DBGET integrated database retrieval system