KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0177200-01Help
Entry
Os01t0177200-01   CDS       T02163                                 

Gene name
Os01g0177200
Definition
Similar to Ubiquitin-specific protease 14.
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Os01t0177200-01 (Os01g0177200)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os01t0177200-01 (Os01g0177200)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os01t0177200-01 (Os01g0177200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(3986771..3986866,3986965..3987145,3987668..3987780,3987854..3988190,3989022..3989116,3989330..3989463,3989548..3989604,3989711..3989788,3990333..3990387,3991159..3991239,3991369..3991567,3991642..3991699,3991770..3991892,3992440..3992528,3993450..3993539,3993619..3993792,3993911..3994035,3994246..3994372,3994826..3994998)
AA seq 794 aa AA seqDB search
MDLLRSHLHKVRIPEPGSRIHKDECCVSFDTPRSEGGLYVDMTSFLGFGREHVAWNYEKS
GNPVYLHIVQRRKPEPDDEADRPLKKPTLLAIGVEGGFTDQEPEYDEAFEIVILPEFTSL
PFPSIDLPEKVRIAVDKVILAESADRKQQLASWVADKKKVSAHAMDLKQLDNGVIVPPTG
WKCSKCDKTENLWLNLTDGMILCGRRLWDGSGGNNHAIEHYEQTKYPLAVKLGTITADLE
AADVFSYPEDDSVEDPLLAQHLSHFGIDFSSLQKTEMTTAERELDHNTNYDWNRIQESGK
DAELLYGPGYTGLVNLGNSCYMASVMQVMFSTHPFISRYFEKQSLKAAFAIAPADPTLDL
NMQMTKLAHGMLSGKYSVPNQEGQEGIHPRMFKTVIAAKHPEFSSMRQQDALDFFLHLID
QVDQANTGNHELNPFTGFKFFIEERLQCPSGKVSYNKRSDYILSLNIPLHEATNKEQLEA
FHEKKAAMDLDGKEVSNEEIVRPRVPLEACLASFSGAEEVPEFYSTALNSKTTAIKTAGF
KTFPDYLVLQMRKFVMEAGWVPKKLDVYVDVPDIIDISHMRSKGIQPGEELLPEGASGDN
KAEPVHPVASEDIVSQLASMGFNYLHCQKAAISTSNTGVEEAMNWLLSHMDDPDINDPIS
KDSQAAEQTVDETSVQTLVSFGFQEDVARKALAASGGNIERATDWIFSHPEAFSSVPTDS
STSNMEDDDAHIPDGSGRYKLMAFVSHMGTSTHCGHYVAHVLKDGRWVIFNDSKVAASVD
LPKDMGYLYFFQRI
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctccgctcgcacctccacaaggtccgcatcccggagcccggcagccgcatc
cacaaggacgagtgctgcgtctccttcgacaccccgaggtcggagggtgggctgtacgtc
gacatgacctcgttcctggggttcgggagggagcacgtggcgtggaactacgagaagagt
gggaaccccgtgtacctccacatcgtgcagcgccggaagccggagcccgacgacgaggcg
gatcgcccgctgaagaagcccacgctactcgccatcggagtggagggaggtttcactgat
caagaacccgaatacgatgaggcttttgaaattgttatcttgcctgaatttacttctctc
ccttttccatcaattgacttgccagagaaggttaggattgcagttgacaaagttatactt
gccgaaagtgctgatcgaaaacaacaattggcttcttgggttgctgacaagaaaaaagtc
agtgcacatgctatggatctgaagcagctagacaatggtgtcattgtgccacctacagga
tggaagtgcagcaagtgtgataaaactgagaatctctggttaaatttaactgatggcatg
atcctatgtgggaggcggctttgggatggaagtggggggaataatcatgctattgaacac
tacgaacagactaaatatcctcttgcggtaaagcttggaacaattactgctgatttagaa
gcagcagacgttttctcatacccagaagatgatagcgttgaagatccactattagcgcag
catttgtcacattttggtattgatttttcttcactccaaaagaccgagatgactactgct
gaaagagagcttgatcacaacacaaattatgactggaatagaatacaagaaagtggcaaa
gatgccgaacttttatacggccctggttatactggccttgtaaatcttggaaatagttgc
tatatggcctcagtaatgcaagttatgttttcaactcatccttttatatcacgctacttt
gagaagcagagcttgaaagctgcatttgcaattgccccagctgatccaacattggacttg
aacatgcaaatgacaaagttggctcatggaatgctctctggcaaatactctgtgccaaat
caggagggacaagaaggaatacaccctcgtatgtttaagacagttattgctgcaaagcat
cccgaattttccagtatgaggcaacaggatgcgcttgatttcttccttcatcttattgac
caagttgatcaggcaaacaccggaaaccatgagctgaatccttttacagggttcaaattc
ttcattgaggagcgtcttcaatgcccttctggaaaagtctcctataacaaacgttctgac
tacattctttctttgaacataccgttacatgaagctactaacaaagagcagctagaagca
tttcatgagaagaaagctgcaatggatttggatggaaaggaagtgtctaatgaggaaatt
gtgaggcctagagtcccactggaggcatgcttagcaagtttttcaggcgcggaggaagtg
cctgaattttacagcactgcattgaattcaaagacaacagcaattaagactgctggcttt
aaaacatttcctgattacctggtgttgcagatgcgcaagtttgtaatggaagcaggatgg
gtgccaaagaaactagatgtatacgtagatgtgccagatataattgatatctcgcacatg
cgcagcaaaggcatacagcctggtgaagagctactacctgaaggagcttctggtgataac
aaagctgaacctgttcatcctgttgccagtgaggacattgtatctcagctggcaagcatg
gggttcaattatcttcattgccagaaagctgctattagtacatcaaacacaggagttgag
gaggcgatgaattggcttctctcacacatggatgatccagatatcaacgatccaatatct
aaagattcacaggctgctgaacaaactgttgatgaaactagcgttcaaactcttgtttcc
ttcggatttcaagaagatgttgctcgaaaggccttggcagcttctggtggaaatatcgag
agagcaacagactggatttttagccaccctgaggcttttagctcagtacctactgattct
tcaacaagcaatatggaagatgatgatgcacacataccagatggaagtggcagatacaaa
ttgatggcgtttgtgagccatatgggcacctctacccattgtgggcactacgttgcccat
gtcctcaaagacgggaggtgggtaatattcaatgatagtaaggttgctgcctctgtcgac
ttgcccaaggatatgggatacctgtatttctttcaaaggatataa

DBGET integrated database retrieval system