KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0183000-01Help
Entry
Os01t0183000-01   CDS       T02163                                 

Gene name
Os01g0183000
Definition
Similar to GmCK3p (EC 2.7.1.32) (Fragment).
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dosa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(4395103..4395513,4395641..4395762,4395862..4396057,4396275..4396392,4396499..4396546,4396691..4396791,4396893..4397000)
AA seq 367 aa AA seqDB search
MVAVDPPPREAAAAPPAMKRSASFDRVPEEARRILHRLAGELWGGDVDPAALAVSQLKGA
MTNEVFRITWPGGGGGEGEGEGDHRKVLVRIYGQGVEVFFDRADEVRTFECMSRHGQGPR
LLGRFPNGRIEEFINARTLSAADLRDAEISSLIAKKLREFHDLDMPGPKNVSLWQRLRRW
LEEARGRCSPEEARQFSLEKLGDEIAMLDIALSGVDQRVGFCHNDLQYGNIMIYEETRQV
TLIDYEYASFNPVAFDIANHFCEMSADYHSATPHVLDFTKYPGIDEQRRFVQTYLSSSGE
NPSDAEVEHLLGLIAKYSLASHIFWGLWGIISGHVNKNIDFEYQEYARQRFDQYWKTKDQ
TLGSKSN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgtcgacccgccgccgcgggaggccgcggccgccccgcccgccatgaagcgg
agcgcgagcttcgaccgcgtcccggaggaggcgcgccgcatcctgcaccgcctcgccggg
gagctctggggcggcgacgtcgaccccgccgcgctcgccgtgtcccagctcaagggcgcc
atgaccaacgaggtgttccggatcacctggcccggcggcggcggcggcgagggcgagggc
gagggcgaccaccgcaaggtgctcgtccgcatctacggccagggcgtcgaggtcttcttc
gaccgcgccgacgaggtccgcaccttcgagtgcatgtcccgccacggccagggcccccgc
ctcctcggccgcttccccaacggccgcatcgaggagttcatcaacgcgaggacgctctcc
gcggcggatctgcgcgacgcggagatatcctcgctgatcgccaagaagcttcgtgaattc
cacgatctcgacatgcctggacccaagaacgtgtcactgtggcagaggctgaggaggtgg
cttgaggaagctcgtggcaggtgctcgcccgaggaggctaggcagttcagtttggagaag
ctaggtgatgagatcgcaatgctggacattgcattgtcaggggttgatcagagagtagga
ttttgccacaatgatctgcaatatggcaacattatgatatatgaagaaaccagacaagtg
accttaattgactacgagtatgcgagttttaatcctgtggcatttgacattgctaatcac
ttctgtgagatgtctgctgattatcattcagccacacctcatgtgctggacttcacaaaa
taccctggcattgacgaacaacgcagatttgttcaaacgtacctcagctcttcaggtgag
aacccatcagatgcggaagttgaacatttacttggcctgattgcaaaatacagtcttgca
agccatatcttctggggtctttggggaataatctcagggcatgtgaacaagaacatcgac
ttcgagtaccaggagtatgcaaggcagcggttcgatcagtactggaagacaaaagatcaa
acgctgggatccaaatccaactag

DBGET integrated database retrieval system