KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0191700-01Help
Entry
Os01t0191700-01   CDS       T02163                                 

Gene name
Os01g0191700
Definition
Similar to Pyrophosphate-fructose-6-phosphate 1-phosphotransferase-like protein (Pyrophosphate-dependent phosphofructo-1-kinase-like protein).
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os01t0191700-01 (Os01g0191700)
   01230 Biosynthesis of amino acids
    Os01t0191700-01 (Os01g0191700)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os01t0191700-01 (Os01g0191700)
   00030 Pentose phosphate pathway
    Os01t0191700-01 (Os01g0191700)
   00051 Fructose and mannose metabolism
    Os01t0191700-01 (Os01g0191700)
   00052 Galactose metabolism
    Os01t0191700-01 (Os01g0191700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Os01t0191700-01 (Os01g0191700)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Os01t0191700-01 (Os01g0191700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(4905790..4905996,4906437..4906483,4906623..4906662,4906770..4906970,4907260..4907472,4907561..4907629,4907711..4907840,4907934..4907974,4908063..4908287,4908575..4908778,4908901..4909119)
AA seq 531 aa AA seqDB search
MEAVGVAPAPAGVPEKKLLEVKESRKAAPAAPSTSMAAKWAMKKKLVGGDAGYVLEDVPH
LTDYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVHKTSARGTHFRRAGPRQRV
YFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGIEGGYKGFYSRNTVALT
PKSVNDIHKRGGTVLGTSRGGHDTGKIVDSIKDRGINQVYIIGGDGTQKGASVIYEEVRR
RGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGR
NSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDNGHMVIVVAEGAGQDL
IAKSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKRNFPITLKYIDPTYMIRAVRSNA
SDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLC
STNQPCFLSHEDVEHLKHDDDEHHLHNTQLLEGESSPVKDSSKCNGTAAPV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtcggcgtggctccggcccccgcgggggtgccggagaagaagctgctcgaa
gtgaaggagtcccggaaggcggcgccggcggcgccgtcgacgtcgatggcggccaagtgg
gcgatgaagaagaagctcgtcggcggcgacgccgggtacgtgctcgaggacgtgccccac
ctcacggactacctgcccgagcttccgacttacccgaatcctctgcaagacaacccggct
tattcagtcgtcaagcaatacttcgtcaacactgacgacaccgtcacgcaaaagatcgtt
gttcataagaccagtgctaggggcacccatttccggcgagccgggccgcggcagcgggtg
tacttccagtccgatgaggtcaacgcggccattgtcacctgcggtggcctctgccctgga
cttaacactgttatccgcgagcttgtgtgcggcttgtatgatatgtatggcgtcaccagc
gtcgttggcatagagggtggatacaagggtttctattctagaaacaccgtcgcactgaca
ccgaaatcggtgaatgacatccacaagagaggtgggactgttcttggaacctccagagga
ggccatgacaccggcaaaatagttgacagtattaaggatcgcggtattaaccaggtgtat
attattggaggtgatggtacccagaaaggtgcttccgtaatttatgaggaagttcggagg
cgaggcctcaaatgttctgtggttggtgtcccaaagaccatagataacgacattgcggtg
atcgacaagtcctttggttttgacactgcggtggaggaggctcagagggccatcaatgct
gctcatgttgaggctgagagtgcagagaatggcattggtgttgtgaaactaatggggcgc
aacagtgggttcatcgcaatgtatgctactctggctagtcgcgatgtggattgttgctta
atcccagagtctccattctatctagaaggaaaaggtggactccttgaattcatcgagaaa
cggctcaaggacaatggccatatggtcattgtagtggctgagggtgctgggcaagatctc
attgcgaaaagcatgaattttgtggatactcaagatgcttctggaaataagctacttctg
gatgttggcctttggctctcccagaagatcaaggatcatttcaagaagaagcgcaacttc
cccatcactctcaagtacatcgacccgacatacatgatccgtgccgtcaggtcaaacgca
tccgacaacgtctactgcaccctgctagctcacagcgccctccacggcgccatggcgggg
tacaccggcttcaccgtcgcgccggtcaacggcaggcacgcgtatatcccgttctacaga
atcacggagaagcagaacaaggtggtgatcacggacaggatgtgggcgagggtgctgtgc
tcgacgaaccagccatgcttcctgagccacgaggacgtcgagcacctcaagcacgacgac
gacgagcaccacctgcacaacacgcagctcctcgaaggcgagagctcgccggtgaaggac
tcctccaagtgcaacgggacagcagcgccagtgtga

DBGET integrated database retrieval system