KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0232700-01Help
Entry
Os01t0232700-01   CDS       T02163                                 

Gene name
Os01g0232700
Definition
Similar to Histidinol dehydrogenase, chloroplast precursor (EC 1.1.1.23) (HDH). Splice isoform 2.
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Os01t0232700-01 (Os01g0232700)
  Amino acid metabolism
   00340 Histidine metabolism
    Os01t0232700-01 (Os01g0232700)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Os01t0232700-01 (Os01g0232700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(7348680..7348886,7349030..7349082,7349175..7349247,7349493..7349594,7349697..7349798,7349888..7349959,7350067..7350129,7350210..7350251,7350620..7350679,7350755..7350865,7351044..7351214,7351392..7351482,7351571..7351845)
AA seq 473 aa AA seqDB search
MSLRPGRAHPLAASPLHTPLPARPRPQLRLSTSTSCAAMKSYRLSELSDAEVGGLKARPR
IDFSSIFGTVNPIVEDVRMRGDAAVKDYTVKFDKVALDDVVVRVSDLPDVELDPAVKEAF
DVAYDNIYAFHVSQKLPEKTVENMKGVRCKRITRCIGSVGLYVPGGTAVLPSTALMLAVP
AQIAGCKTVVLATPPSRDGSICKEVLYCAKKAGVTHVLKAGGAQAISAMAWGTVSCPKVE
KIFGPGNQYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADKYANPVHVAADLLSQAEHGP
DSQVVLVVAGDGVDLGAIEAEVSKQCSALPRGEFASKALGHSFTVFAKDMVEAISFSNMY
APEHLIINVKDAEQWEDLVENAGSVFLGQWTPESVGDYASGTNHVLPTYGYARMYSGVSL
NSFLKYITVQSLSEEGLRSLGPHVAKMAEVEGLEAHRRAVTLRLQDIEATVTV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgcggccgggcagggcgcaccccctcgccgcgtctcccctccacaccccgctc
cctgctaggcctaggccccagctgaggctgagcacctccaccagctgcgccgccatgaag
tcgtacaggctgtcggagctcagcgacgccgaggtcggcggcctcaaggcgcgcccccgc
atcgacttctcctccattttcggcacggtcaatccgattgttgaagacgtgcgcatgcga
ggcgatgctgcggtcaaggattatacagtgaagttcgacaaggttgcactcgatgatgtg
gttgtgcgtgttagcgatcttccggatgtggagcttgatccagctgtgaaggaagccttt
gatgtggcatatgacaacatttatgccttccacgtttcgcaaaagttgcctgaaaagact
gttgagaatatgaaaggtgtaagatgtaaaagaataacaagatgcattggttctgttggc
ctttatgtcccaggtggcactgcagtattgccttccactgcattgatgcttgctgtgcct
gcacagattgctggttgcaaaactgttgttcttgccacaccccctagtcgtgatggtagc
atatgtaaggaggttctttactgtgctaaaaaagctggtgtgacacatgtattgaaagct
ggaggagctcaggccatttcagccatggcatggggaacagtctcatgcccaaaggttgaa
aaaatatttggacctggaaatcagtatgtcacggctgcaaaaatgattcttcagaacagt
gaagccatggtttctatagacatgcctgctggcccttcagaagtattagtgatagcggat
aaatatgcaaacccagttcatgttgctgctgatttgttatctcaggcggaacatggccca
gacagtcaggttgttctagttgttgcgggagacggtgttgatttgggtgctattgaggca
gaagttagcaagcagtgctctgctcttcctaggggagaatttgcttcgaaagctcttggc
cacagtttcactgtttttgcgaaagacatggttgaggcaatttcattctccaatatgtat
gcccctgagcatttgatcatcaatgtaaaggatgctgaacagtgggaggatcttgtcgag
aatgcagggtcggtcttcttgggacaatggaccccggagagcgtgggcgactatgcaagc
ggcacaaaccatgtccttccaacctatggttacgcaaggatgtatagcggcgtgtcactg
aactcattcctcaagtacatcactgtccagtccttgtcagaggaagggttgagaagtctg
ggtccgcatgtggcaaagatggctgaagtcgaaggactagaggctcacagaagagctgtt
accctcagacttcaggacatcgaagccactgtaaccgtgtag

DBGET integrated database retrieval system