KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0246100-01Help
Entry
Os01t0246100-01   CDS       T02163                                 

Gene name
Os01g0246100
Definition
Zinc finger, RING/FYVE/PHD-type domain containing protein.
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Os01t0246100-01 (Os01g0246100)
Transcription factors [BR:dosa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Os01t0246100-01 (Os01g0246100)
Mitochondrial biogenesis [BR:dosa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Os01t0246100-01 (Os01g0246100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(8054622..8054788,8054205..8054313,8053718..8053937,8053452..8053634,8052364..8053364,8051823..8052098,8051463..8051738,8050626..8050754,8050308..8050508,8050063..8050205,8049698..8049983,8049455..8049594,8049099..8049177,8048670..8049014,8047995..8048212,8047819..8047876))
AA seq 1276 aa AA seqDB search
MMAKTLQGTQQQYAASGFPTQQYPTSGWTQSAAEILQLDNMDQDTSVVRNIIHRKIVEYL
NERKEFCNFDLSFLMEIGKCIDRHLFEKADSKIKYMDLETLRTRLNAIVNSASFRGSMFH
WSASAASSKLNSQQLPVMEVPIYHDRVTPGPNNLPSCAYNVSSTQGYNQYENCMGAANFA
HSLADKPKQMPERLANTIFTSCASTLPKCSPSIDVLHIGHIKEHFSGDAYQNDSSQPSTS
GSSSSLSAVWDQTTCSSAMRTLPMDSFSTVNGQNLSTNNKSLYPTTGQGPLLQQYIECEM
KQETWSRSLEQSDQSNITTGNRDLYHAQIHPYINGEHKRDRCIQMKEKLGHTSDHEGFSR
EKSSNLSNHFMHHQQGFMTNYGACSPVSKTVDRAEQTSNSTVSKPTSPASDGSSGKHYPA
KRLKVDVPHLVHVNEMEASKEQQPAANETYASAETVQSEVTNSPTKSPCCTSLGDNIACT
DNVHGMDMVRLSGSAVQTEEEFRRENSDIEMKDAKVDLLDQTLSGDSLRARKRRGASVLY
ALTSEELKDHLCTLNHDTSQSKVPTEELLSVEGLPDQNTCNLCGMERLLFEPPPRFCALC
FKIINSTGSYYVEVENGNDKSSICGRCHHLSSAKAKYQKRFSYAETDAEAEWWVQCDKCK
AWQHQICALFNPKIVDPEAEYTCAKCFLKEKDNEDVDSLEPSTILGARELPRTRLSDHIE
QRLSERLVQERQQRAIASGKSVDEVPGVEGLTVRVVSSADRTLQVQPRFKDFFKKEQYPG
EFPYKSKAILLFQKNEGVDVCLFAMYVQEYGSACPSPNQRHVYLAYIDSVKYFRPEIKSA
SGEALRTFVYHEILIGYLDFCKKRGFVSCSIWTCPSTKRDDYVLYCHPTIQKMPKSDKLR
SWYQNLVKKAVKEGVVVERNTLYDFFLQPTNECKTNISAAWLPYCDNDFWPGEAERLLEK
KDDDTSQKKETQLGRLLRVAKRDDRKGNLEDILLVHKLGERLRTMKEDFLMLCLQQFCKH
CHHPIVSGSSWVCTSCKNFFLCERCYAEELNTPLKDRHPATTKQKHAFERIEEEPLPETD
DVDPTMESKYFDSRIDFLKHCQDNQYQFDTLRRAKHSTMMILYHLHDSTCSSCHRAMDQC
LAWRCLVCLGCNFCDSCYKQDGESLHIHKLRQKKDHHVLQKYTLQDYLEGLVHASRCFDR
SCTSKLCLTLKKLFFHGVRCHTRARGGGGCHMCVFMWKLLFTHSLLCDNADCSAPRCRDI
KAYIADRSMTDLSISG
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaagaccctgcaagggactcaacagcaatatgcagcaagtggatttcctacc
cagcaataccccacaagtggctggacacaatctgcagctgaaattcttcagttggataat
atggatcaagatacatccgtagttcgcaatattattcaccgtaaaattgtagagtaccta
aatgagcggaaggaattctgcaactttgacctatcctttcttatggaaattggaaaatgt
attgaccgacatctttttgagaaagctgattcaaagattaagtatatggatcttgaaact
ttaagaaccaggttgaatgctatcgtcaattctgcatcatttcggggtagtatgtttcat
tggagtgcttcagcagcttcatccaaactaaactcacaacagctgcctgtgatggaggtg
cccatctaccatgatagagttactcctggacctaataatctgccctcctgtgcatataat
gtatcctccactcagggatataaccaatatgaaaactgtatgggtgctgctaactttgct
cattcgttggctgataaacccaagcagatgcctgaaagattagcaaacaccatttttacc
tcatgtgcatcaactctaccgaaatgtagccctagtattgatgtactgcatattggccat
ataaaagaacatttctcaggtgatgcgtatcaaaatgatagttcacaaccatcaacctct
gggagttctagttctttgtcagcagtgtgggatcaaacaacatgttctagtgcaatgaga
acacttccgatggattctttctcaacagtgaacggacaaaacctttccacaaacaataaa
agtttgtatcccacaaccggtcagggacctttgttgcaacaatacatagaatgtgagatg
aagcaagagacgtggagtcggtcactagagcaatcagatcagtcaaacattaccactgga
aaccgtgacttgtatcatgctcaaattcatccgtacatcaatggagagcacaaacgggat
cgatgcattcaaatgaaagaaaaacttgggcatacttctgatcatgaaggtttctccagg
gagaaaagctcaaatttaagcaaccactttatgcatcatcagcagggcttcatgactaat
tatggtgcttgtagccctgtaagcaagacagtggatagagctgaacagacatcaaatagt
actgtatcaaagccgacttcacctgcttcagatggatcttctggcaagcattatccagca
aaacgcttgaaagttgatgttccccatcttgtccatgtcaatgaaatggaggcttcaaag
gaacaacaacctgctgccaatgagacttatgcatctgctgaaacagtacaatctgaagtc
actaattcaccaacaaaatcaccatgttgtacttccttgggggacaacattgcttgcacc
gataatgtacatggaatggatatggtcagattgtcggggagtgctgtacaaactgaagaa
gaatttcgtcgtgaaaatagtgacattgagatgaaggatgcaaaggttgatttattggac
caaacattgtcaggggacagcctgagggcaaggaagagaagaggggcctcagtactttat
gcattaacttctgaggagcttaaagatcacttgtgtactctgaaccatgatacttctcag
agcaaagtgccgactgaagagctgctatcagttgaaggcttgcctgatcagaacacatgc
aatttatgtgggatggaaagactcctctttgagccccctccacgattttgcgcgctctgt
tttaaaataattaattctacaggatcctattatgttgaagtggaaaatggaaatgacaaa
tcttcaatatgtggcagatgccaccatcttagtagtgccaaagccaaatatcagaagaga
ttcagctatgcagagacagatgctgaggcagaatggtgggtccagtgcgataagtgcaaa
gcttggcagcatcaaatctgcgcactttttaaccccaaaatcgtggatccagaggctgaa
tatacttgtgcaaaatgtttcttgaaggaaaaggataatgaagatgttgattcacttgag
ccatctactattctgggagcacgcgagttaccaagaactagactaagtgatcatattgag
caaaggctttctgagcggcttgtgcaggagcggcaacagagggcaattgcttctggaaaa
agtgttgatgaggtaccaggagttgaaggtcttactgttagagtggtatcttcagctgat
agaacactgcaagtccaaccacgtttcaaggatttttttaaaaaagaacaatatcctggg
gaatttccgtacaaatcaaaggccattctcttgtttcaaaagaatgaaggtgtagatgta
tgcctgttcgccatgtatgtgcaagagtatggttcagcctgcccatcaccaaatcaaagg
cacgtttatcttgcatatattgattctgtcaagtacttcagaccggaaatcaagtcggcc
agtggagaagctctccgtacctttgtgtatcatgaaattttgattggctacttggatttc
tgcaagaaacgagggtttgtaagctgttccatatggacttgcccatctacaaagcgtgac
gattatgttttatattgtcatcctacaatacagaagatgccaaagtctgacaagcttcgg
agctggtaccagaatttggtaaagaaggctgttaaggagggggtagttgtggaacggaat
acactctatgacttcttccttcagcccaccaatgaatgcaagaccaatatctcagctgca
tggttgccatactgtgataatgatttctggcctggggaagcagagaggctccttgaaaag
aaagatgatgacacctcacagaagaaagaaactcaactaggaaggcttctacgggttgcc
aaacgtgatgaccggaaaggaaacctcgaggatattttacttgtgcataagcttggagaa
aggttgcgaaccatgaaagaagattttttaatgctttgtctgcagcaattttgcaagcat
tgccaccatcctattgtatctggtagtagttgggtttgcaccagctgcaaaaacttcttt
ctttgtgaacgttgttatgctgaggagctgaatacccctctgaaggacaggcacccagct
acaacaaaacaaaagcatgcatttgaaagaatagaggaagaacctcttccagaaacggat
gatgtagatccaacaatggaaagcaagtactttgacagcagaatagatttcctgaagcat
tgtcaagacaatcaataccagtttgatactctccggagggcaaaacattccacaatgatg
attctttatcatctacatgattcaacttgttcttcttgtcaccgtgccatggatcaatgc
ttggcatggcggtgcttggtttgcctaggctgcaacttttgtgattcatgctataaacaa
gacggtgaaagtttgcatattcataagttgaggcagaaaaaagaccatcacgtattgcag
aagtacactctacaggactaccttgaaggcttggtgcatgcatcaagatgttttgatcga
agttgcacttccaaactttgtttgacgttaaagaaactgttcttccatggtgtacgatgt
catacccgtgcccgtggtggaggaggttgccatatgtgtgtattcatgtggaaactgctg
ttcacgcactcactgctttgtgacaatgcagactgttcagctcccagatgcagggatata
aaggcatatattgctgacagaagcatgacagaccttagtatatctggatga

DBGET integrated database retrieval system