KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0254300-00Help
Entry
Os01t0254300-00   CDS       T02163                                 

Gene name
Os01g0254300
Definition
(RAP-DB) Pectinesterase (EC 3.1.1.11) (Fragment).
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(8450334..8451489,8447761..8448440))
AA seq 611 aa AA seqDB search
MASTGALLLLLLFVLACGGNGGAAAAVFSGCSFESQEEAEAFEAALLQQACFNVTAFGGG
GGGGGGEGGCVSRLDTARGGAGSGPVPVLRAAVRDTLGEAVGAVAAVAGLASLSNHAREE
MAVRDCVELVGYSVDELGWALDAMADPDGGVAAAEEEDETEPETRRRRRRGARAEDDIHA
WLSAAMGNQGTCLDGFHGTDSRLLRRVESAVTQLTQLVSNLLAMHKKLRDITPQHQHQHH
HHPGNNNNKNGTADGAAAGGDDTGPSSDLPPWVTDVVNDVEEEVTATRGRGRSSSSGRKA
MRVDVVVAQDGSGRWRTVSEAVARAPSHSRRRYVIYVKRGVYEENVEVRKKKTNIVIVGE
GMGETVITGSRSMAAGWTTFRSATFAVSGAGFIARDMTIRNTAGPAAHQAVALRVDSDRS
AFFRIAVEGHQDTLYAHSLRQFYRDCRVSGTVDFIFGNGIAVIQRTTISTLPPAAGQNAG
SVTAQGRRDPNQNTGFALHACIVEAKYPTYLGRPWKPFSRVVVMESYLGAGVQPRGWLEW
DGDGGELATLFYGEYRNYGPGANIGGRVRWPGYHVIMDAAVAVRFTVRRFIDGLAWLPST
GVTFTADLNRK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccggcgcgctgcttctgttgctcttgtttgtgcttgcgtgcggcggcaat
ggcggcgcggccgccgcggtgttctccgggtgttcgttcgagagccaggaggaggccgag
gcgttcgaggccgcgctgctgcagcaggcgtgcttcaacgtgacggcgttcggtggaggc
ggaggtggaggtgggggcgagggcggctgcgtgtcgcggctcgacacggcgcgcggcggc
gcggggagtggccccgtgccggtgctccgcgcggcggtccgggacacgctcggcgaggcg
gtgggcgccgtggcggccgtggcggggctcgcgtcgctgtccaaccacgcgcgggaggag
atggccgtgcgcgactgcgtcgagctggtggggtactccgtcgacgagctcgggtgggcg
ctcgacgccatggccgaccccgacggcggcgtcgccgcggcggaggaggaggatgagacg
gagccggagacgaggcgccgccgccgccgcggcgcgcgcgccgaggacgacatccacgcc
tggctcagcgcggcgatgggcaaccagggcacctgcctcgacggcttccacggcaccgac
agccgcctcctccgccgcgtcgagtcggccgtgacgcagctcactcagctcgtcagcaac
ctcctcgccatgcacaagaagctccgcgacatcacgccgcagcaccaacaccaacaccac
caccaccccggcaacaacaacaacaagaacggcacagccgacggcgccgccgccggaggg
gatgacaccggcccgtcgtcggatctaccgccatgggtgacggacgtcgtcaacgatgtc
gaggaggaggtcacggcgacgcgcggacgagggaggtcgtcgtcgtcgggaaggaaggcg
atgcgcgtggacgtggtggtggcgcaggacgggagcgggcggtggcggacggtgagcgag
gcggtggcgcgggcgccgagccacagcaggaggaggtacgtgatctacgtgaagcgaggg
gtgtacgaggagaacgtggaggtgaggaagaagaagacgaacatcgtcatcgtcggcgag
gggatgggggagacggtcatcaccggcagccggagcatggccgccggctggaccaccttc
cggagcgccacgtttgcggtgtcgggggcggggttcatcgcacgggacatgacgattcgg
aacacggcggggccggcggcgcaccaggcggtggcgctgcgcgtcgactccgatcgctcc
gccttcttccgcatcgccgtcgagggccaccaggacacgctctacgcgcactccctccgc
cagttctaccgcgactgccgcgtctccggcaccgtcgacttcatcttcggcaacggcatc
gccgtcatccagcgcaccaccatctctaccctcccgcccgccgccggccagaacgccggc
agcgtcacggcgcagggccggagggaccccaaccagaacaccggcttcgccctccatgct
tgcatcgtggaggccaagtacccgacctacctcggacgcccgtggaagcccttctcccgg
gtggtcgtcatggagtcctacctcggcgcaggtgtccagccgcgcggatggctggagtgg
gacggcgacggcggcgagctcgccacgctattctacggggagtaccgcaactatgggcct
ggcgccaacatcggcggccgggtgcggtggcccggataccacgtgatcatggacgccgcc
gtcgctgtgcgcttcaccgtgcggcggttcatcgacggcctcgcttggctaccctccacc
ggcgtcaccttcaccgctgacctcaacaggaaatga

DBGET integrated database retrieval system