KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0286600-01Help
Entry
Os01t0286600-01   CDS       T02163                                 

Gene name
Os01g0286600
Definition
Similar to Plastidal protoporphyrinogen oxidase.
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dosa00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(10291957..10292331,10292421..10292606,10292688..10292772,10292847..10292994,10293069..10293149,10293575..10293746,10294308..10294467,10294600..10294703,10294903..10295202)
AA seq 536 aa AA seqDB search
MAAAAAAMATATSATAAPPLRIRDAARRTRRRGHVRCAVASGAAEAPAAPGARVSADCVV
VGGGISGLCTAQALATKHGVGDVLVTEARARPGGNITTAERAGEGYLWEEGPNSFQPSDP
VLTMAVDSGLKDDLVFGDPNAPRFVLWEGKLRPVPSKPGDLPFFDLMSIPGKLRAGLGAL
GVRAPPPGREESVEDFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWRLEDT
GGSIIGGTIKTIQERGKNPKPPRDPRLPTPKGQTVASFRKGLTMLPDAITSRLGSKVKLS
WKLTSITKSDNKGYALVYETPEGVVSVQAKTVVMTIPSYVASDILRPLSSDAADALSIFY
YPPVAAVTVSYPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPAGRV
LLLNYIGGSTNTGIVSKTESELVEAVDRDLRKMLINPKAVDPLVLGVRVWPQAIPQFLIG
HLDHLEAAKSALGKGGYDGLFLGGNYVAGVALGRCVEGAYESASQISDYLTKYAYK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgccgcagccatggccaccgccacctccgccacggcagcgccgccgctc
cgcattcgcgacgccgcgaggaggacccgccgacgcggccacgttcgctgcgccgtcgcc
agcggcgcggccgaggcgcccgcggcgcccggggcgcgggtgtcggcggactgcgtcgtg
gtgggcggcggcatcagcgggctctgcaccgcgcaggcgctggccacaaagcacggcgtc
ggcgacgtgctcgtcacggaggcccgcgcccgccccggcggcaacatcaccaccgccgag
cgcgccggcgagggctacctctgggaggaggggcccaacagcttccagccttccgacccc
gtcctcaccatggccgtggacagcgggctcaaggacgatctcgtgttcggggaccccaac
gcgccgcggttcgtgctgtgggaggggaagctaaggccggtgccgtccaagcccggcgac
ctgccgttcttcgacctcatgagcatccccggcaagctcagggccggccttggcgcgctc
ggcgttcgagcgccacctccagggcgtgaggagtcggtggaggacttcgtgcggcgcaac
ctcggcgcggaggtctttgagcgcctcattgagcctttctgctcaggtgtgtatgctggt
gatccttcaaagctcagtatgaaggctgcatttgggaaggtgtggaggctggaggatact
ggaggtagcattattggtggaaccatcaaaacaatccaggagagggggaaaaaccccaaa
ccgccgagggatccccgccttccaacgccaaaggggcagacagttgcatctttcaggaag
ggtctgactatgctcccggatgctattacatctaggttgggtagcaaagtcaaactttca
tggaagttgacaagcattacaaagtcagacaacaaaggatatgcattagtgtatgaaaca
ccagaaggggtggtctcggtgcaagctaaaactgttgtcatgaccatcccatcatatgtt
gctagtgatatcttgcggccactttcaagtgatgcagcagatgctctgtcaatattctat
tatccaccagttgctgctgtaactgtttcatatccaaaagaagcaattagaaaagaatgc
ttaattgacggagagctccagggtttcggccagctgcatccgcgtagtcagggagttgag
actttaggaacaatatatagctcatcactctttccaaatcgtgctccagctggaagggtg
ttacttctgaactacataggaggttctacaaatacagggattgtttccaagactgaaagt
gagctggtagaagcagttgaccgtgacctcaggaagatgctgataaatcctaaagcagtg
gaccctttggtccttggcgtccgggtatggccacaagccataccacagttcctcattggc
catcttgatcatcttgaggctgcaaaatctgccctgggcaaaggtggttatgatggattg
ttcctcggagggaactatgttgcaggagttgccctgggccgatgcgttgaaggtgcatat
gagagtgcctcacaaatatctgactacttgaccaagtacgcctacaagtga

DBGET integrated database retrieval system