KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0286600-01Help
Entry
Os01t0286600-01   CDS       T02163                                 

Gene name
Os01g0286600
Definition
Similar to Plastidal protoporphyrinogen oxidase.
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Os01t0286600-01 (Os01g0286600)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Os01t0286600-01 (Os01g0286600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(10291957..10292331,10292421..10292606,10292688..10292772,10292847..10292994,10293069..10293149,10293575..10293746,10294308..10294467,10294600..10294703,10294903..10295202)
AA seq 536 aa AA seqDB search
MAAAAAAMATATSATAAPPLRIRDAARRTRRRGHVRCAVASGAAEAPAAPGARVSADCVV
VGGGISGLCTAQALATKHGVGDVLVTEARARPGGNITTAERAGEGYLWEEGPNSFQPSDP
VLTMAVDSGLKDDLVFGDPNAPRFVLWEGKLRPVPSKPGDLPFFDLMSIPGKLRAGLGAL
GVRAPPPGREESVEDFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWRLEDT
GGSIIGGTIKTIQERGKNPKPPRDPRLPTPKGQTVASFRKGLTMLPDAITSRLGSKVKLS
WKLTSITKSDNKGYALVYETPEGVVSVQAKTVVMTIPSYVASDILRPLSSDAADALSIFY
YPPVAAVTVSYPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPAGRV
LLLNYIGGSTNTGIVSKTESELVEAVDRDLRKMLINPKAVDPLVLGVRVWPQAIPQFLIG
HLDHLEAAKSALGKGGYDGLFLGGNYVAGVALGRCVEGAYESASQISDYLTKYAYK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgccgcagccatggccaccgccacctccgccacggcagcgccgccgctc
cgcattcgcgacgccgcgaggaggacccgccgacgcggccacgttcgctgcgccgtcgcc
agcggcgcggccgaggcgcccgcggcgcccggggcgcgggtgtcggcggactgcgtcgtg
gtgggcggcggcatcagcgggctctgcaccgcgcaggcgctggccacaaagcacggcgtc
ggcgacgtgctcgtcacggaggcccgcgcccgccccggcggcaacatcaccaccgccgag
cgcgccggcgagggctacctctgggaggaggggcccaacagcttccagccttccgacccc
gtcctcaccatggccgtggacagcgggctcaaggacgatctcgtgttcggggaccccaac
gcgccgcggttcgtgctgtgggaggggaagctaaggccggtgccgtccaagcccggcgac
ctgccgttcttcgacctcatgagcatccccggcaagctcagggccggccttggcgcgctc
ggcgttcgagcgccacctccagggcgtgaggagtcggtggaggacttcgtgcggcgcaac
ctcggcgcggaggtctttgagcgcctcattgagcctttctgctcaggtgtgtatgctggt
gatccttcaaagctcagtatgaaggctgcatttgggaaggtgtggaggctggaggatact
ggaggtagcattattggtggaaccatcaaaacaatccaggagagggggaaaaaccccaaa
ccgccgagggatccccgccttccaacgccaaaggggcagacagttgcatctttcaggaag
ggtctgactatgctcccggatgctattacatctaggttgggtagcaaagtcaaactttca
tggaagttgacaagcattacaaagtcagacaacaaaggatatgcattagtgtatgaaaca
ccagaaggggtggtctcggtgcaagctaaaactgttgtcatgaccatcccatcatatgtt
gctagtgatatcttgcggccactttcaagtgatgcagcagatgctctgtcaatattctat
tatccaccagttgctgctgtaactgtttcatatccaaaagaagcaattagaaaagaatgc
ttaattgacggagagctccagggtttcggccagctgcatccgcgtagtcagggagttgag
actttaggaacaatatatagctcatcactctttccaaatcgtgctccagctggaagggtg
ttacttctgaactacataggaggttctacaaatacagggattgtttccaagactgaaagt
gagctggtagaagcagttgaccgtgacctcaggaagatgctgataaatcctaaagcagtg
gaccctttggtccttggcgtccgggtatggccacaagccataccacagttcctcattggc
catcttgatcatcttgaggctgcaaaatctgccctgggcaaaggtggttatgatggattg
ttcctcggagggaactatgttgcaggagttgccctgggccgatgcgttgaaggtgcatat
gagagtgcctcacaaatatctgactacttgaccaagtacgcctacaagtga

DBGET integrated database retrieval system