KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0338200-01Help
Entry
Os01t0338200-01   CDS       T02163                                 

Gene name
Os01g0338200
Definition
Mov34/MPN/PAD-1 family protein.
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Os01t0338200-01 (Os01g0338200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Os01t0338200-01 (Os01g0338200)
Peptidases [BR:dosa01002]
 Metallo Peptidases
  Family M67
   Os01t0338200-01 (Os01g0338200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(13296475..13296600,13296843..13296907,13296991..13297084,13297223..13297393,13297479..13297585,13298453..13298558,13298661..13298707,13300550..13300868,13301038..13301127,13301216..13301278,13301424..13301498,13302500..13302562,13304047..13304099,13304808..13304982)
AA seq 517 aa AA seqDB search
MGPPQQARGGGIDIEACARPIAVDHRIKLPYYFRIAGNLLRQAKIYRDENNLVDLYVILL
RYSSLVCETIPKHRDYHTFKLREVDFFRLAPHNQSKLIEVLSELESLKPVVQRQITEHNR
ARGGAIESNSINGTIAVNNITKQHMTNPYTYQPFVGSNNGSFERPVPGGNHQMAPLMSAQ
PDRLTRKQLANLPFPKEETLARHSILGPNGLHGQWTGPVTAIKVQYPSNLDIIKSDVSSL
FPSVLNQDGQNGPSTISTDSTQIENDDMKSVLSLDDGRWSKLAEECASVPSVSLEEELSQ
LSIKQPSPPPVLAELERRPIAPSEVADPTPGLAVSETGRYQNLHVPVKLMECFLRVAEAN
TKRSLETCGVLAGTLKKRTFYVTALIIPKQKSTSDSCEATNEDELFDVQDKGSLFTLGWI
HTHPTQSCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDTRRKHGIFHLSDPGGMGVIHDCP
ERGFHPHKAPLDGSPIYEHCSHVYMNPDVKFDVIDLR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggggccgccgcagcaggccaggggcggcggcatcgacatcgaggcgtgcgcgcgcccg
atcgccgtcgaccaccgcatcaagctcccctactacttccgcatcgccgggaacctcctc
cgccaggctaagatatatcgagacgagaataatctcgtcgacctgtatgtcatcctcctg
cgttactcgagcttggtttgcgagacgattccaaagcaccgtgactaccatacattcaag
ttgagagaagtggatttcttcaggcttgctccacataatcaatctaaactaattgaagtg
ctcagtgagcttgagtcactgaagccagttgtgcagcggcaaatcactgagcataacaga
gcaagaggaggtgccatcgaatccaatagtataaatggaaccattgctgtaaataatata
acaaaacagcatatgacaaatccttatacatatcagccatttgtaggaagcaacaatgga
tcatttgaaagacctgtccctggtgggaatcatcaaatggcaccattaatgagtgctcaa
cctgatagactgacccgcaaacaacttgcaaatctccctttccctaaagaagaaacatta
gctagacactctatattgggacctaatgggcttcatgggcaatggactgggcctgttact
gcaatcaaggttcagtatccaagcaatcttgatataataaaaagcgatgtgtctagttta
tttccatctgtcttgaaccaagatggtcagaatggtcccagtacaatatccacagatagc
actcaaattgagaatgatgatatgaaatctgttctgtcccttgatgatggtcgatggtct
aagctggcagaggaatgcgcctctgtaccttctgttagtctggaagaagaattatcccaa
ttgagtatcaaacagccttcacctcctccagtcttggcagagttagagcgcaggccaatt
gctccatcagaagttgcagatccaacaccaggacttgctgtctcagaaaccgggcgttat
cagaacttacatgttccggtaaagttgatggaatgttttctaagggttgctgaggcaaac
actaagagaagtttagaaacatgtggagttcttgctggtaccctgaaaaagagaaccttt
tatgtgactgccttgataattccaaagcagaaatctacatctgattcatgtgaagcgaca
aatgaagatgaattatttgatgttcaggacaagggctcgcttttcactcttggttggatt
cacacacatccaacacagtcctgcttcctgtcttccattgatctccataatcattattct
tatcaggtgatgttacctgaagcaattgcaatagttatggcacctactgacacaagaaga
aaacatggtatatttcatctctctgatcctggcggtatgggtgtgatccatgattgcccg
gagagaggattccatcctcataaggcccctctagatggttcaccaatttatgagcattgc
tcccatgtgtatatgaaccccgatgtaaagtttgatgtgattgaccttcgataa

DBGET integrated database retrieval system