KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0339900-01Help
Entry
Os01t0339900-01   CDS       T02163                                 

Gene name
Os01g0339900
Definition
Thioredoxin domain 2 containing protein.
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dosa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(13353741..13353928,13355054..13355138,13355332..13355429,13355516..13355571,13355785..13355902,13356010..13356037,13356142..13356233,13356442..13356598,13356690..13356814,13356906..13357005,13357112..13357180)
AA seq 371 aa AA seqDB search
MAIPRISPRKTLPLFAALALALAWAFAAPAFADGDDVVALTESTFEKEVGQDRGALVEFY
APWCGHCKKLAPEYEKLGASFKKAKSVFIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSL
EPKKYEGQRSAEALAEFVNTEGGTNVKLATIPSSVVVLGPDNFDSIVLDENKDILVEFYA
PWCGHCKHLAPIYEKLASVYKLDDGVVIANLDADKHKDLAEKYGVSGYPTLKFFPKGNKA
GEDYDGGRELDDFVKFINEKCGTSRDTKGQLTSEAGRIASLDALAKEFLGAANDKRKEIL
SNMEEEVVKLSGSAAKHGKVYIAIAKKILDKGHDYTKKETERLERMLEKSISPSKADEFI
IKKNVLSTFSS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcccccgcatctcgccgcgcaaaaccctgcccctcttcgccgccctggccctg
gccttggcctgggccttcgccgccccggcgttcgccgacggcgacgacgtcgtcgccctc
acggagtccaccttcgagaaggaggtcggccaggaccgcggcgccctcgtcgagttctac
gcgccctggtgtggtcactgcaagaagcttgcccctgagtatgaaaagcttggtgcaagt
ttcaagaaagccaaatctgtctttattgcaaaggttgattgcgatgagcacaagagtgtg
tgcagcaagtatggagtttctgggtacccaacaattcaatggttccccaaaggatccctg
gagcccaaaaagtatgaaggacaacgcagtgcagaggcccttgctgaatttgttaacact
gaaggaggcactaatgtaaagctggcaaccattccttcaagtgttgtagtgcttggccca
gacaactttgactcaattgttcttgatgaaaacaaagacattcttgtggagttctatgcg
ccatggtgtggccactgcaagcatcttgctccgatatatgagaagctggcttctgtttat
aagttggacgatggagttgtaattgctaaccttgatgctgacaaacacaaagacttggcc
gaaaaatatggagtttctggctatcctacattgaagttcttcccaaagggaaacaaagct
ggtgaagattacgatggcggcagggagttggatgactttgtcaagttcattaatgagaag
tgtggtaccagccgtgatactaagggccaacttacttcagaggcggggcgcatagcaagt
ttggatgccctcgcaaaggagttccttggtgctgccaatgacaagcggaaggaaatcctc
tccaatatggaagaggaggttgtgaagctcagtggttctgctgcaaagcatggaaaggtc
tacattgccattgcaaagaaaatcctggacaaaggtcacgactataccaagaaggaaaca
gagaggcttgaacgcatgttggagaagtccatcagcccatcaaaggccgatgaattcatc
atcaagaagaacgtcctttcaaccttctcttcctaa

DBGET integrated database retrieval system