KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0348600-01Help
Entry
Os01t0348600-01   CDS       T02163                                 

Gene name
Os01g0348600
Definition
Similar to MFP2 (Fatty acid multifunctional protein) (AtMFP2).
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Os01t0348600-01 (Os01g0348600)
  Lipid metabolism
   00071 Fatty acid degradation
    Os01t0348600-01 (Os01g0348600)
   00592 alpha-Linolenic acid metabolism
    Os01t0348600-01 (Os01g0348600)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Os01t0348600-01 (Os01g0348600)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Os01t0348600-01 (Os01g0348600)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Os01t0348600-01 (Os01g0348600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(13887485..13887593,13888527..13888598,13888724..13888789,13888888..13888944,13889038..13889105,13889189..13889270,13889566..13889621,13889766..13890068,13890163..13890249,13890320..13890494,13890602..13890723,13890810..13890973,13891046..13891300,13891433..13891554,13891663..13891784,13892232..13892380,13892467..13892605,13892836..13892871)
AA seq 727 aa AA seqDB search
MAAAAAAKGRTEMEVGADGVAVITICNPPVNSLSIDVLLSLKENYAEALRRNDVKAIVVT
GKGGKFSGGFDISSFGSVQGGKVEQPKVGYISIDIITDTLEAATKPSVAAIDGLALGGGL
EVAMACHARISTPTAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMMLLSKPIKGAEA
HQLGLVDSLVSADDLVNTARRWALDICELKRPWIKSLYKTDKLEPLGEAREILKFARAQA
RRQAANLEHPLVCIDVIEEGIVSGPRAGLWKEANAFQGLLFADTCKNLVHVFFSQRATSK
VPGATDLGLMPRKVTKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGIDRIKAN
LQSRVRKGKMTEERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDLEKYCP
SHCVLATNTSTIDLNLIGEKTRSKDRIVGAHFFSPAHVMPLLEIVRTQHTSPQVVVDLLD
VGKKIKKTPIVVGNCTGFAVNRMFFPYTQSALLFVDLGMDVYKIDRACTKFGMPMGPFRL
ADLVGFGVAAATGMQYLENFPERVYKSMLIPLMMEDKRTGEASRKGFYKYEDKRKATPDP
EIMKYIEKSRSMAGVTPDTELMKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIAS
IFGMGFPPYRGGIMFWADSIGAKYIHDKLEVWAKRYSDIFKPCSYLAERAANGVPLSAPA
KQVKARL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcggcggcggcgaaggggaggacggagatggaggtcggagcggacggcgtc
gccgtcatcaccatctgcaacccgcccgtcaactcgctctccatcgatgtattgctaagc
ttaaaggaaaactatgctgaagctcttcggaggaatgatgtgaaagctattgttgttaca
gggaaaggaggaaaattttctggaggatttgatattagttcctttggtagtgttcagggt
ggcaaagttgaacagccaaaggttggttacatatcaatagatattatcactgatacccta
gaagctgcaacaaagccatcagtggctgcaattgatggtcttgctcttggtggaggattg
gaagttgctatggcatgccatgcacgcatttcaactcccacagctcaattaggacttcca
gaacttcaacttggagttattccaggatttggaggaacacaacgactcccgcgtcttgtt
ggattgacaaaagcacttgaaatgatgctgctatctaagccaattaagggtgcagaggca
caccaattgggtcttgttgattccttggtttctgctgatgatttggttaatactgctcgt
cgttgggctttggatatctgtgaattaaaaaggccatggatcaaaagtctttataagact
gacaaactagaaccacttggtgaggctagggagattctcaagtttgcaagagctcaagct
cgaaggcaggctgccaatcttgagcatccgcttgtttgtattgatgtcattgaagaaggt
attgtttcgggaccccgagctgggctctggaaggaagcaaatgctttccagggtcttctt
ttcgcggatacatgtaaaaacttagttcatgtattcttttctcaacgggcaacatcaaag
gttcctggtgctacagacttgggattgatgcctaggaaagttactaaagttgccattcta
ggtggtggacttatgggttcaggaattgcaactgcgatgatactgagtaattatcctgtt
atactcaaagaagtaaatgagaagtttctaaatgctggaattgacagaattaaagccaat
ttgcagagtcgtgtgaggaaagggaaaatgacagaggagagatatgagaaagccatgtct
cttgtaacaggtgtcctcgattatgaaaggttcaaagacgtggatttagttattgaggct
gttattgaaaatgtgaaattgaaacagcaaatattttctgacttggagaagtactgtcct
tcccattgtgtccttgctactaatacatctacaattgatcttaatctaattggtgagaaa
acaaggtccaaagaccgtattgtcggtgcacacttctttagccctgcacatgtcatgcca
cttctggaaatagtccgcacccagcacacctcaccacaagttgtcgttgatttgcttgat
gttgggaagaaaatcaagaagacaccaatagtggttgggaactgtaccggtttcgcagtc
aacagaatgttctttccttacactcagtcagcactcctgttcgttgatcttggtatggat
gtgtacaagatcgatcgtgcatgtaccaaatttggaatgcccatgggtccattcagactg
gcagacctcgttggttttggtgttgctgcggccactggtatgcagtaccttgagaacttc
ccagagagggtctacaagtcaatgttgattcctcttatgatggaggacaaaaggacaggt
gaggcctctcggaagggcttttacaagtatgaggacaagaggaaggcaactcctgatccc
gaaattatgaaatatattgaaaaatctaggagtatggctggagtaacaccagacactgag
ttgatgaagctaagtgagaaggacatagttgagatggtcttcttcccagtcataaatgag
gcttgccgtgttcttgatgagggaattgcagtcaaggcttctgaccttgacattgcctca
atctttggcatgggattcccaccgtataggggaggaatcatgttctgggcagattccatt
ggtgcaaagtacatccatgacaagttggaggtgtgggcgaagcggtatagcgacatcttc
aagccttgttcctaccttgcagaaagagcagcaaatggggttcctctgagtgcaccagct
aagcaagtcaaggcccgactatag

DBGET integrated database retrieval system