KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0349400-01Help
Entry
Os01t0349400-01   CDS       T02163                                 

Gene name
Os01g0349400
Definition
Similar to Serine/threonine protein phosphatase PP1 (EC 3.1.3.16) (Fragment).
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dosa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(13927128..13927329,13924081..13924640,13923815..13924006,13922929..13922952))
AA seq 325 aa AA seqDB search
MMMTRASMGAMEGAAVDEVVRRLVEGGRGGRQVQLSEAEIRQLCVEAKRVLLSQPNLLRI
HAPVKICGDIHGQFVDLLRLFDLGGYPPTSTYLFLGDYVDRGKQSLETICLLLAYKVKYP
DKIFLLRGNHEDAKINRVYGFYDECKRRFNVRLWKIFCDCFNCLPMAALIDDKILCMHGG
LSPELNSLDQIKDIERPTEIPDYGLLCDLVWSDPSPDSEGWGESDRGVSCTFGADKLVEF
LEKNDLDLICRAHQVVEDGYEFFAQRRLVTIFSAPNYCGEFDNAGALLSIDESLMCSFQI
LKPNDTGAPHSRKPTSNKTPKTGNA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacgcgggcgtcgatgggggcgatggaaggcgcggcggtggacgaggtggtg
cggcgcctcgtggagggcgggcgcggggggaggcaggtgcagctgtcggaggcggagatc
cggcagctctgcgtcgaggcgaagcgggtgctcctgtcgcagccgaacctcctgcgcatc
cacgcccccgtcaagatctgcggtgatatccatgggcaatttgttgatcttctgaggctg
tttgatttgggcggttatcctccaacttccacttatcttttccttggagattatgtggac
agaggcaaacaaagcttggaaaccatatgcttgcttctggcatacaaagtgaagtatcct
gataagattttcctgttaaggggaaaccatgaagatgcgaaaattaacagagtgtatggt
ttctatgatgaatgtaagaggcgattcaatgttcgactgtggaagattttctgtgattgc
ttcaactgcttgcctatggcagcactcattgacgataagatactctgcatgcatggtggc
ctctcacctgaactgaatagcttggatcaaataaaggatatcgagaggcccactgagatt
cctgactatggtcttttgtgtgatttagtttggtctgatcctagtcctgactcagaaggg
tggggagagagtgacagaggtgtttcctgcacttttggtgcagataagcttgtagaattt
ttggagaagaatgatcttgatcttatatgccgcgctcatcaggttgttgaggatggctac
gagttctttgcgcaaaggagattagtgacaatcttttcagctccaaactattgtggggaa
tttgataatgcgggtgctctgttgagcatagatgaaagtttaatgtgttcttttcaaatc
ttgaagccaaatgatacaggggctccacattcaaggaaaccaacttcaaacaagacccca
aaaactggaaacgcttaa

DBGET integrated database retrieval system