KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0372500-00Help
Entry
Os01t0372500-00   CDS       T02163                                 

Gene name
Os01g0372500
Definition
Similar to Leucoanthocyanidin dioxygenase (EC 1.14.11.19) (LDOX) (Leucocyanidin oxygenase) (Leucoanthocyanidin hydroxylase).
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    Os01t0372500-00 (Os01g0372500)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     Os01t0372500-00 (Os01g0372500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(15346762..15347889)
AA seq 375 aa AA seqDB search
MTDVELRVEALSLSGVSAIPPEYVRPEEERADLGDALELARAASDDDATARIPVVDISAF
DNDGDGRHACVEAVRAAAEEWGVIHIAGHGLPGDVLGRLRAAGEAFFALPIAEKEAYAND
PAAGRLQGYGSKLAANASGKREWEDYLFHLVHPDHLADHSLWPANPPEYVPVSRDFGGRV
RTLASKLLAILSLGLGLPEETLERRLRGHELAGVDDDLLLQLKINYYPRCPRPDLAVGVE
AHTDVSALSFILHNGVPGLQVHHAGSWVTARPEPGTIVVHVGDALEILTNGRYTSVLHRG
LVSRDAVRLSWVVFCEPPPESVLLQPVPELLADGADKPLFAPRTFKQHVQRKLFEKLKDQ
QDNNAAAASNGMRTK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtggagctgagagtggaggccctcagcctcagcggcgtctccgccatcccg
ccggagtacgtccgcccggaggaggagcgcgccgacctcggcgacgccctggagctcgcc
cgggccgcgtccgacgacgacgccaccgcccgcatccccgtcgtcgacatctccgcgttc
gacaacgacggcgacggcaggcacgcgtgcgtggaggcggtgcgcgcggcggcggaggag
tggggcgtcatacacatcgccggccacggcctcccgggcgacgtcctcggccgcctgcgc
gccgcgggcgaggcgttcttcgcgctgcccatcgcggagaaggaggcgtacgccaacgac
ccggcggcggggcggctgcaggggtacggcagcaagctcgccgccaacgccagcgggaag
agggagtgggaggactacctgttccacctcgtccacccggaccacctcgccgaccactcg
ctctggccggcgaacccgccggagtacgtccccgtgtcgcgcgacttcggcggccgcgtc
cggaccctcgcatccaagctgctcgccatcctctccctcggcctcggcctgccggaagag
acgctggaacgccgcctgagaggacatgagctggccggcgtcgacgacgacctgctcctt
cagctcaagatcaactactacccgaggtgcccgcggcctgacctcgccgtcggcgtcgag
gcacacaccgacgtcagcgcgctctccttcatcctccacaacggcgtgccggggctgcag
gtgcaccacgccgggagctgggtcaccgcgcgccccgagccgggcaccatcgtcgtccac
gtcggcgacgccctggagatcctcaccaacggccggtacaccagcgtgctccaccgcggc
ctcgtcagccgcgacgccgtgcgcctctcctgggtcgtcttctgcgagccgccgcctgag
tccgtgctgctgcagccggtgccggagctgctcgccgacggcgccgacaagccgctcttc
gcgccgcgcacattcaagcagcacgtgcaacgcaagctgttcgagaagctcaaggatcag
caagacaacaatgccgcagctgcatcgaacggaatgagaactaaataa

DBGET integrated database retrieval system