KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0499300-01Help
Entry
Os01t0499300-01   CDS       T02163                                 

Gene name
Os01g0499300
Definition
Mov34/MPN/PAD-1 family protein.
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Os01t0499300-01 (Os01g0499300)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os01t0499300-01 (Os01g0499300)
Peptidases [BR:dosa01002]
 Metallo Peptidases
  Family M67
   Os01t0499300-01 (Os01g0499300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(17217732..17217860,17217463..17217527,17217274..17217367,17216887..17217051,17216697..17216803,17215840..17215945,17215705..17215751,17215287..17215605,17215020..17215109,17214874..17214936,17213862..17213936,17213212..17213274,17212376..17212428,17210548..17210728))
AA seq 518 aa AA seqDB search
MSMPSSRQAMGEINIEAMARPVSVDHRISIAYYFRIADNLLRQANIYREEKNLVDLYIIL
LRYSSLLCETIPKHRDYHAFKLREKEFLKKGPHNSDKLLNVVNELETLKPVVLRQIADLN
RGVTQEPNSQSGTSAAISQMDHLTQSSCFTQPLVGSPTGLLKMPFSGGKHQVEPTQSGRP
DSQLVKSYGNLPYPKEETLSRHSVLGPNGLHGKWTAPVTGIRIQYPSNAELTKSDVSSLV
PSILNQDLLYGPSRSQDFPTNKNEDMQSVLSLDDGQLSLPVEEATSVSPGFEEEFSQLNI
RQPSPPPVMAQVHPQHRAISTSTVADLGPGIASSSTGRYQNLHVPVTLMECFLRVAEANT
ANNLETCGILAGTLKKRTFYVTTLIIPKQRSTSDSCQATNEEEIFEVQDKGSLFTLGWIH
THPTQTCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDTTRKHGIFHLTDPGGMGVIHDCQE
SGFHPHEEPLDGTSIYEHCSHVYMNPNVKFDMVDLREL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgccatcatctcgccaagctatgggagaaatcaacatcgaggcgatggcacgc
ccagtctccgtcgaccaccgcatcagcatcgcctactatttccgcatcgccgacaacctc
ctccgccaggccaacatatatagggaggagaagaatctcgtagacctttacatcatcctt
ctgagatactcgagtttgctgtgtgagactatcccaaaacatcgtgattatcatgcattc
aagctacgagaaaaggaattcttgaagaaaggcccacacaattctgataaactcttgaat
gttgttaatgagcttgagactctgaagccagttgtgctacggcaaattgctgaccttaat
agaggggtcacacaagaacctaatagtcaaagtggaacctctgctgcaattagtcagatg
gatcatcttacccaaagttcatgtttcacacagccattggttggaagccctacaggatta
ttgaagatgccattctctggagggaagcatcaagtggaaccaacacaaagtggcagacct
gatagtcagcttgtcaaatcatatggcaatctgccttatcctaaagaagaaactctatcc
agacattcggtactggggcctaatgggcttcatggcaaatggacggcacctgttactggt
atcaggatccaatatccaagtaatgctgaactaaccaaaagtgatgtctctagtttagta
ccatcaatcttgaaccaagacctcttatatggtcctagtagatcacaagattttccaaca
aataaaaatgaggatatgcaatctgttttgtccctagacgatggccaattgtctttacca
gtagaggaggcaacctctgtgtctcctggttttgaagaagaattttcccagttgaatatc
aggcaaccttctcccccacctgtcatggcacaagtacatccacagcatagggcaatttct
acatcaacagttgctgatctggggccaggaattgctagttctagcactggacgctatcag
aatttgcatgtgccggtgacattaatggagtgttttctgagggttgctgaggcaaacact
gcaaataatctggaaacatgtggtattcttgctggtactctgaaaaagagaactttttat
gtgacaacactgataattcctaagcagagatcaacatctgattcatgtcaagctacaaat
gaagaagaaatatttgaagttcaggacaaaggctcacttttcactcttggttggattcat
acacatccaacacagacctgcttcctatcttccattgatcttcataatcactattcatac
caggtcatgcttcctgaagcaattgcaatagttatggcacctactgatacaacaagaaag
catggtatatttcatctgacggatccaggtggtatgggtgtgatacatgattgtcaagag
agtggatttcatcctcatgaggagcctctcgacggtacctctatctatgagcattgctcc
catgtgtacatgaacccaaacgtgaaatttgatatggtggatctccgtgaactgtga

DBGET integrated database retrieval system