KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0510100-01Help
Entry
Os01t0510100-01   CDS       T02163                                 

Gene name
Os01g0510100, MITOGEN-ACTIVATED_PROTEIN_KINASE_KINASE_6, MKK6
Definition
MAP kinase kinase 1.
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    Os01t0510100-01 (Os01g0510100)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Os01t0510100-01 (Os01g0510100)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Os01t0510100-01 (Os01g0510100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr01:join(17905076..17905149,17905649..17905736,17906086..17906223,17906711..17906935,17907067..17907249,17907368..17907588,17909531..17909576,17909675..17909767)
AA seq 355 aa AA seqDB search
MRGKKPHKELKLSVPAQETPVDKFLTASGTFKDGELRLNQRGLQLISEETADEPQSTNLK
VEDVQLSMDDLEMIQVIGKGSGGIVQLVRHKWVGTLYALKGIQMNIQEAVRKQIVQELKI
NQATQNAHIVLCHQSFYHNGVIYLVLEYMDRGSLADIIKQVKTILEPYLAVLCKQVLEGL
LYLHHERHVIHRDIKPSNLLVNRKGEVKITDFGVSAVLASSMGQRDTFVGTYNYMAPERI
SGSSYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYELLEAIVDQPPPSAPADQFS
PEFCAFISSCIQKDPAERMSASELLNHPFIKKFEDKDLDLRILVESLEPPMNISE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagggggaagaagccgcacaaggagctcaagctctccgtgcctgcgcaggagacgccc
gtcgacaagttcctgaccgcgagtggtacattcaaggatggtgaactgcggcttaatcaa
agaggtttgcagcttatatccgaggaaactgcagatgaacctcagtcaacaaacctgaag
gtggaagatgttcagttgtcaatggatgaccttgagatgattcaagtcattggtaagggg
agtggtggtatcgtccaactagttcggcacaagtgggtggggacattatatgccttgaag
ggcatacaaatgaacattcaagaggcagttcgcaaacaaatagtacaagagctcaaaata
aatcaagcaacacagaacgcacatatagtcctttgccaccaatctttctaccataatggt
gtaatatatcttgttctagaatacatggaccgtggatctcttgcagatatcattaaacaa
gtcaaaacaattctggagccatacctggcagtactttgcaaacaggttttggagggtcta
ctgtatcttcatcatgaaaggcatgtgattcacagggatataaagccatctaacttgtta
gttaaccgtaaaggtgaagtaaagattaccgattttggggtaagtgcggtgctagcaagt
tcaatgggtcagcgggatacgtttgttggaacctacaactatatggcgcctgagcgtatt
agtggaagctcctatgactacaagagtgacatatggagtttgggcttagtaatactcgag
tgtgccattggtcggttcccctatataccttcagaaggggaaggttggttaagcttctac
gaattattagaagcaattgttgaccagccaccaccctctgcaccagcggaccagttctct
ccagaattttgtgcatttatctcctcctgcatacaaaaggatcctgcggagcggatgtct
gcttcagaactcttgaatcatcctttcatcaagaagtttgaggataaggatttagacctg
cgcattcttgtcgagagccttgaacctccaatgaatatatccgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system